@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0540: (2015-12-01 )
MTELIDGKALSQKMQAELGRKVERLKEQHGIIPGLAVILVGDNPASQVYVRNKERSALEAGFKSETLRLSESISQEELIDIIHQYNEDKSIHGILVQLPLPQHINDKKIILAIDPKKDVDGFHPMNTGHLWSGRPMMVPCTPAGIMEMFREYHVDLEGKHAVIIGRSNIVGKPMAQLLLDKNATVTLTHSRTRNLSEVTKEADILIVAIGQGHFVTKDFVKEGAVVIDVGMNRDENGKLIGDVVFEQVAEVASMITPVPGGVGPMTITMLLEQTYQAALRSVSL

Atome Classification :

(28 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

L34_A_6(4B4V)
?
[Raw transfer]




9L9_A_6(4B4W)
?
[Raw transfer]




L34_B_9(4B4V)
?
[Raw transfer]




9L9_B_7(4CJX)
?
[Raw transfer]




9L9_A_5(4CJX)
?
[Raw transfer]




9L9_B_9(4B4W)
?
[Raw transfer]




NDP_C_3(1A4I)
C1TC_HUMAN
[Raw transfer]




NAP_A_4(1DIG)
C1TC_HUMAN
[Raw transfer]




NDP_C_3(1A4I)
C1TC_HUMAN
[Raw transfer]




NAP_D_4(1DIB)
C1TC_HUMAN
[Raw transfer]




NDP_D_4(1A4I)
C1TC_HUMAN
[Raw transfer]




L34_E_5(1DIB)
C1TC_HUMAN
[Raw transfer]




NAP_A_3(1DIA)
C1TC_HUMAN
[Raw transfer]




NAP_B_5(1DIG)
C1TC_HUMAN
[Raw transfer]




NAP_C_3(1DIB)
C1TC_HUMAN
[Raw transfer]




NAP_B_4(1DIA)
C1TC_HUMAN
[Raw transfer]




L24_A_5(1DIA)
C1TC_HUMAN
[Raw transfer]




L37_A_6(1DIG)
C1TC_HUMAN
[Raw transfer]




NAD_A_3(3P2O)
FOLD_CAMJE
[Raw transfer]




NAD_A_3(3P2O)
FOLD_CAMJE
[Raw transfer]




EDO_B_14(4B4U)
?
[Raw transfer]




EDO_A_7(4B4U)
?
[Raw transfer]




NAP_B_7(4B4W)
?
[Raw transfer]




IMD_A_4(3L07)
FOLD_FRATT
[Raw transfer]




IMD_B_7(3L07)
FOLD_FRATT
[Raw transfer]




IMD_A_4(3L07)
FOLD_FRATT
[Raw transfer]




83 HHSearch 96.4054%-113 * C5 *3P2O 7.8 FOLD_CAMJE
1 PsiBlast_PDB 94.3653%-114 - C5 -3P2O 7.8 FOLD_CAMJE
81 HHSearch 94.1051%-112 - C5 -3L07 3.9 FOLD_FRATT
2 PsiBlast_PDB 93.0551%-117 - C5 -3L07 3.9 FOLD_FRATT
21 PsiBlast_CBE 92.6751%-116 - C5 -3L07 3.7 FOLD_FRATT
3 PsiBlast_PDB 92.4750%-110 - C5 -1B0A - FOLD_ECOLI -
70 Fugue 92.0949%-108 - C5 -1B0A - FOLD_ECOLI -
84 HHSearch 91.7750%-107 - C5 -1B0A - FOLD_ECOLI -
24 PsiBlast_CBE 91.3644%-110 - C5 -4B4U 3.0 ?
6 PsiBlast_PDB 91.0944%-110 - C5 -4B4V 5.7 ?
5 PsiBlast_PDB 91.0544%-106 - C5 -4B4U 2.7 ?
7 PsiBlast_PDB 90.9144%-107 - C5 -4B4W 5.1 ?
22 PsiBlast_CBE 90.8844%-109 - C5 -4B4W 5.9 ?
23 PsiBlast_CBE 90.8244%-109 - C5 -4B4V 5.6 ?
25 PsiBlast_CBE 89.9245%-112 - C5 -4A26 - ? -
4 PsiBlast_PDB 89.2149% -95 - C5 -4A5O - FOLD_PSEAE -
28 PsiBlast_CBE 89.1144%-109 - C5 -1DIB 9.0 C1TC_HUMAN
82 HHSearch 89.1045%-106 - C5 -1A4I 10.3 C1TC_HUMAN
8 PsiBlast_PDB 89.0145%-117 - C5 -4A26 - ? -
26 PsiBlast_CBE 88.9144%-106 - C5 -1A4I 10.0 C1TC_HUMAN
11 PsiBlast_PDB 88.9044%-109 - C5 -1DIB 9.1 C1TC_HUMAN
12 PsiBlast_PDB 88.8044%-110 - C5 -1DIG 9.2 C1TC_HUMAN
30 PsiBlast_CBE 88.6739%-110 - C5 -4CJX 6.2 ?
15 PsiBlast_PDB 88.6339%-109 - C5 -4CJX 6.4 ?
10 PsiBlast_PDB 88.4444%-111 - C5 -1DIA 7.8 C1TC_HUMAN
29 PsiBlast_CBE 88.3644%-108 - C5 -1DIA 9.0 C1TC_HUMAN
27 PsiBlast_CBE 88.2444%-108 - C5 -1DIG 8.5 C1TC_HUMAN
9 PsiBlast_PDB 88.0444%-108 - C5 -1A4I 10.3 C1TC_HUMAN