@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0565: (2015-12-01 )
MALIEMSGVTKKYRRSTTALRNLNLSIQQGEFVYLVGPSGAGKSSLIRLLYREEKLSSGRLKVGEFNLNKLKRRQIPILRRSIGVVFQDYKLLPTKTVYENVAFAMQVIGAKRRHIKKRVPEVLELVGLKHKMRSFPTQLSGGEQQRVAIARAIVNNPKLLIADEPTGNLDPEIAWEIMHLLERINLQGTTVLMATHNSQIVNTLRHRVIEIEAGSVIRDEEKGEYGYHD

Atome Classification :

(25 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_J_5(4YMV)
?
[Raw transfer]



ATP_J_5(4YMU)
?
[Raw transfer]



ATP_A_7(4YMU)
?
[Raw transfer]



ATP_A_6(4YMV)
?
[Raw transfer]



ATP_A_5(1B0U)
HISP_SALTY
[Raw transfer]
3 PsiBlast_PDB 91.2138%-112 - C1 -3TUZ - METN_ECOLI -
116 HHSearch 90.6138%-106 * C1 *3TUI - METN_ECOLI -
27 PsiBlast_CBE 90.5638%-115 - C1 -1L2T - Y796_METJA -
24 PsiBlast_CBE 90.2438%-107 - C1 -3TUI - METN_ECOLI -
2 PsiBlast_PDB 89.8938%-107 - C1 -3TUI - METN_ECOLI -
5 PsiBlast_PDB 89.8438%-113 - C1 -1L2T - Y796_METJA -
22 PsiBlast_CBE 89.8338%-108 - C1 -3TUZ - METN_ECOLI -
26 PsiBlast_CBE 89.7338%-106 - C1 -3TUI - METN_ECOLI -
25 PsiBlast_CBE 89.4438%-107 - C1 -3TUI - METN_ECOLI -
23 PsiBlast_CBE 89.4238%-106 - C1 -3TUZ - METN_ECOLI -
48 PsiBlast_CBE 89.0037%-113 - C1 -3TIF - Y796_METJA -
104 Fugue 88.8038%-106 - C1 -3TUZ - METN_ECOLI -
21 PsiBlast_CBE 88.1438%-108 - C1 -3TUZ - METN_ECOLI -
47 PsiBlast_CBE 88.0537%-116 - C1 -3TIF - Y796_METJA -
1 PsiBlast_PDB 87.2938%-107 - C1 -3DHW - METN_ECOLI -
28 PsiBlast_CBE 86.3138%-123 - C1 -4KI0 - ? -
29 PsiBlast_CBE 85.6438%-125 - C1 -4KI0 - ? -
30 PsiBlast_CBE 85.4738%-124 - C1 -3RLF - MALK_ECOLI -
35 PsiBlast_CBE 85.1738%-120 - C1 -3PUV - MALK_ECOLI -
34 PsiBlast_CBE 84.8238%-121 - C1 -3PUW - MALK_ECOLI -
82 PsiBlast_CBE 77.3931%-107 - C1 -4YMV 4.9 ?
83 PsiBlast_CBE 76.3531%-104 - C1 -4YMV 3.8 ?
85 PsiBlast_CBE 76.3431%-108 - C1 -4YMU 4.6 ?
84 PsiBlast_CBE 76.1931%-104 - C1 -4YMU 5.0 ?
92 PsiBlast_CBE 75.5132%-115 - C1 -1B0U 4.0 HISP_SALTY