@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0597: (2015-12-02 )
MKILTVEDDKLIREGISEYLSEFGYTVIQAKDGREALSKFNSDINLVILDIQIPFINGLEVLKEIRKKSNLPILILTAFSDEEYKIDAFTNLVDGYVEKPFSLPVLKARIDSLIKKNFGHLEKFEYKNLSVNFNSYTAKINDEKIDVNAKELEILKCLLDNDGQVLTRMQIIDYVWKDSEEIPYDRVVDVYIKELRKKLQLDCITTIRNVGYKLERK

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACY_C_3(1NXW)
?
[Raw transfer]




PG4_A_4(3A0U)
?
[Raw transfer]




109 HHSearch 87.7733%-111 - C4 -1KGS - ? -
2 PsiBlast_PDB 85.6133%-110 - C4 -1KGS - ? -
106 HHSearch 85.6029%-113 - C5 -1YS7 - PRRA_MYCTU -
103 HHSearch 82.0429%-107 - C5 -2GWR - MTRA_MYCTU -
3 PsiBlast_PDB 80.2627%-111 - C4 -4KFC - KDPE_ECOLI -
4 PsiBlast_PDB 79.9627%-116 - C4 -4KNY - KDPE_ECOLI -
6 PsiBlast_PDB 78.6030%-115 - C5 -1YS6 - PRRA_MYCTU -
7 PsiBlast_PDB 77.5230%-115 - C5 -1YS7 - PRRA_MYCTU -
107 HHSearch 75.2031% -87 - C5 -2OQR - REGX3_MYCTU -
14 PsiBlast_PDB 74.2742%-136 - C4 -1NXX - ? -
15 PsiBlast_PDB 73.9242%-132 - C4 -2A9O - ? -
16 PsiBlast_PDB 73.2942%-134 - C4 -2A9P - ? -
12 PsiBlast_PDB 73.2342%-134 - C4 -1NXV - ? -
9 PsiBlast_PDB 72.9742%-130 - C4 -1NXO - ? -
1 PsiBlast_PDB 72.9429% -85 - C5 -2OQR - REGX3_MYCTU -
13 PsiBlast_PDB 72.9342%-136 - C4 -1NXW 3.9 ?
86 PsiBlast_CBE 71.9735%-124 - C4 -1BDJ - CHEY_ECOLI -
104 HHSearch 71.6822%-111 - C4 -2HQR - ? -
10 PsiBlast_PDB 71.6242%-134 - C4 -1NXP - ? -
17 PsiBlast_PDB 71.3442%-136 - C4 -2A9Q - ? -
23 PsiBlast_CBE 67.0644%-123 - C4 -3A0U 1.5 ?