@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0668: (2015-12-02 )
MKLKVFNVREEEATLAQDWANRNHVELSMSEGPLTLETVNEVEGFDGIANAQIGPLDDAIYPLLKEMGIKQIAQRSAGVDMYNLELAKQHGIIISNVPSYSPESIAEFTVTIALNLIRKVELIRANVREQNFSWTLPIRGRVLGNMTVAIIGTGRIGLATAKIFKGFGCRVIGYDIYHNPMADGILEYVNSVEEAVEKADLVSLHMPPTAENTHLFNLDMFKQFKKGAILMNMARGALVETKDLLEALDQGLLEGAGIDTYEFEGPYIPKNCQGQDISDKDFLRLINHPKVIYTPHAAYYTDEAVKNLVEGALNACVEVVETGTTTTRVN

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_B_4(4XKJ)
?
[Raw transfer]




NAD_A_3(4XKJ)
?
[Raw transfer]




NAD_D_4(1J49)
LDHD_LACDA
[Raw transfer]




NAD_E_5(1J49)
LDHD_LACDA
[Raw transfer]




NAD_A_4(1DXY)
DHD2_LACPA
[Raw transfer]




NAD_A_4(1DXY)
DHD2_LACPA
[Raw transfer]




NAD_A_3(2DLD)
LDHD_LACHE
[Raw transfer]




GOL_A_9(3WWY)
?
[Raw transfer]




GOL_B_14(3WWY)
?
[Raw transfer]




COI_A_5(1DXY)
DHD2_LACPA
[Raw transfer]




10 PsiBlast_PDB 95.2534%-115 - C1 -1XDW - ? -
22 PsiBlast_CBE 93.5035%-114 - C1 -2YQ5 - ? -
5 PsiBlast_PDB 91.2335%-111 - C1 -4PRK - ? -
24 PsiBlast_CBE 90.6935%-112 - C1 -4PRL - ? -
6 PsiBlast_PDB 90.1535%-110 - C1 -4PRL - ? -
23 PsiBlast_CBE 89.7635%-111 - C1 -4XKJ 5.1 ?
1 PsiBlast_PDB 89.6135%-111 - C1 -2YQ4 - ? -
16 PsiBlast_PDB 87.9332%-111 - C1 -3WWY - ? -
21 PsiBlast_CBE 87.6335%-111 - C1 -2YQ5 - ? -
27 PsiBlast_CBE 87.2832%-107 - C1 -1J4A - LDHD_LACDA -
4 PsiBlast_PDB 87.2835%-108 - C1 -4XKJ 5.5 ?
11 PsiBlast_PDB 87.2033%-109 - C1 -4CUJ - ? -
2 PsiBlast_PDB 87.1735%-111 - C1 -2YQ5 - ? -
7 PsiBlast_PDB 86.9533%-108 - C1 -1J49 6.5 LDHD_LACDA
31 PsiBlast_CBE 86.3132%-108 - C1 -3WWY 2.3 ?
14 PsiBlast_PDB 86.0932%-113 - C1 -3WX0 - ? -
26 PsiBlast_CBE 86.0032%-115 - C1 -2DLD - LDHD_LACHE -
75 HHSearch 85.7733%-106 - C1 -1J4A - LDHD_LACDA -
3 PsiBlast_PDB 85.6035%-103 - C1 -1DXY 10.2 DHD2_LACPA
9 PsiBlast_PDB 85.4332%-107 - C1 -1J4A - LDHD_LACDA -
8 PsiBlast_PDB 85.1232%-115 - C1 -2DLD 4.0 LDHD_LACHE
25 PsiBlast_CBE 83.1833%-103 * C1 *1J49 10.1 LDHD_LACDA
70 HHSearch 78.5935% -99 - C1 -1DXY 10.2 DHD2_LACPA
72 HHSearch 77.3831%-102 - C1 -3WWY 3.1 ?