@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0848: (2015-12-03 )
MKTYEKIYQILSKNNNFISGETMANQLNISRTAIWKGIKTLEELGLEIESVTNKGYRLVSGDILLPEQLEQEIGIKVSLNNNSASTQLDAKMGIESKLKTPHLFLAPNQKKAKGRFDRPFFTSNQGGIYMSLLLQPNVPIEDIKPYTVMVASSAVKAISRLTGITPEIKWVNDIYLDNKKIAGILTEAIASVESGLVTNVIIGLGINFYIKEFPRALTKRAGSLFTEQPTITRNQLITEIWNLFFNIPLEDHLKVYREKSLVLDKTVSFMDGQTMYSGKAIDITDKGYLVVELDDGQLKTLRSGEISLSSW

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BT5_A_2(3V8L)
?
[Raw transfer]




BTX_A_2(4DQ2)
?
[Raw transfer]




BT5_A_2(3RKW)
?
[Raw transfer]




BT5_A_2(3RIR)
?
[Raw transfer]




32G_A_2(3V7R)
?
[Raw transfer]




C77_A_2(3V7C)
?
[Raw transfer]




36F_A_2(3V7S)
?
[Raw transfer]




BTN_A_2(3V8K)
?
[Raw transfer]




BTN_A_2(3RKY)
?
[Raw transfer]




BC4_A_2(4HA8)
?
[Raw transfer]




3 PsiBlast_PDB 86.8532% -91 - C2 -3RKW 9.9 ?
4 PsiBlast_PDB 86.8432% -96 - C2 -3RKX - ? -
1 PsiBlast_PDB 86.7032% -89 * C2 *4HA8 5.7 ?
2 PsiBlast_PDB 86.5532% -92 - C2 -3RIR 9.0 ?
23 HHSearch 86.5231%-103 - C2 -3RKX - ? -
8 PsiBlast_PDB 86.4632% -90 - C2 -3V7R 10.0 ?
12 PsiBlast_PDB 86.3732% -89 - C2 -4DQ2 10.2 ?
9 PsiBlast_PDB 86.3732%-100 - C2 -3V8J - ? -
7 PsiBlast_PDB 85.7732% -92 - C2 -3V7S 9.5 ?
5 PsiBlast_PDB 85.6732% -89 - C2 -3RKY 5.1 ?
11 PsiBlast_PDB 85.6132% -91 - C2 -3V8L 10.3 ?
10 PsiBlast_PDB 85.2832% -93 - C2 -3V8K 5.4 ?
6 PsiBlast_PDB 85.1032% -88 - C2 -3V7C 9.5 ?
43 Fugue 84.1730% -89 - C2 -3RKX - ? -
22 HHSearch 80.4126% -92 - C2 -1BIA - BIRA_ECOLI -
16 PsiBlast_PDB 79.3727% -74 - C2 -1BIB - BIRA_ECOLI -
15 PsiBlast_PDB 79.1227% -83 - C2 -1BIA - BIRA_ECOLI -
14 PsiBlast_PDB 79.0827% -76 - C2 -2EWN - BIRA_ECOLI -
13 PsiBlast_PDB 77.1327% -72 - C2 -1HXD - BIRA_ECOLI -
19 PsiBlast_PDB 68.0230% -99 - C2 -1WQW - ? -