@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0955: (2015-12-04 )
MSQSYINVIGAGLAGSEAAYQIAKRGIPVKLYEMRGVKSTPQHKTDNFAELVCSNSFRGDSLTNAVGLLKEEMRRLDSIIMRNGEAHRVPAGGAMAVDREGYSEAVTEEIHKHPLIEVIRDEITDIPGDAITVIATGPLTSDSLAAKIHELNGGDGFYFYDAAAPIVDKNTIDMNKVYLKSRYDKGEAAYLNCPMTKEEFMAFHEALTTAEEAPLNSFEKEKYFEGCMPIEVMAKRGIKTMLYGPMKPVGLEYPEDYKGPRDGEFKTPYAVVQLRQDNAAGSLYNIVGFQTHLKWGEQKRVFQMIPGLENAEFVRYGVMHRNSYMDSPNLLDQTFATRKNPNLFFAGQMTGVEGYVESAASGLVAGINAARRFNGESEVVFPQTTAIGALPHYITHTDSKHFQPMNVNFGIIKELEGPRIRDKKERYEAIATRALKDLEKFLNY

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FAD_A_2(3G5Q)
TRMFO_THET8
[Raw transfer]




FAD_A_2(3G5R)
TRMFO_THET8
[Raw transfer]




FAD_A_2(3G5S)
TRMFO_THET8
[Raw transfer]




FAD_A_2(3G5S)
TRMFO_THET8
[Raw transfer]




2 PsiBlast_PDB 85.5650% -90 - C1 -3G5R 13.4 TRMFO_THET8
38 HHSearch 85.5051% -86 - C1 -3G5S 13.1 TRMFO_THET8
1 PsiBlast_PDB 85.2350% -89 - C1 -3G5Q 13.2 TRMFO_THET8
3 PsiBlast_PDB 83.9648% -86 - C1 -3G5S 13.1 TRMFO_THET8
41 HHSearch 58.2122% -55 - C1 -3CP8 - MNMG_CHLTE -
39 HHSearch 54.8921% -51 - C1 -3CES - MNMG_ECOLI -
35 PsiBlast_CBE 40.7141%-127 - C1 -1COY - CHOD_BREST -
33 PsiBlast_CBE 40.3540%-126 - C1 -1SEZ - PPOM_TOBAC -
56 HHSearch 39.6332% -93 - C1 -3IHG - DNRF_STREF -
34 PsiBlast_CBE 39.5041%-113 - C1 -3COX - CHOD_BREST -
32 PsiBlast_CBE 39.4040%-118 - C1 -1SEZ - PPOM_TOBAC -
52 HHSearch 37.7832% -86 - C1 -3RP8 - HPXO_KLEP7 -
58 HHSearch 37.5619% -82 - C1 -2R0C - ? -
65 Fugue 36.6013% -18 - C2 -1C0P - OXDA_RHOTO -
54 HHSearch 35.3930% -79 - C1 -2DKH - MOBA_COMTE -
53 HHSearch 35.0025% -66 - C1 -1K0I - PHHY_PSEAE -
50 HHSearch 34.9720% -56 - C1 -3NIX - ? -
49 HHSearch 34.8019% -53 - C1 -2QA2 - ? -
61 Fugue 34.2912% -21 - C2 -1GOS - AOFB_HUMAN -
19 PsiBlast_PDB 34.2343% -95 - C1 -4OPU - ? -