@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1271: (2015-12-06 )
MTEFKNIIVTGGAGFIGSNFVHYVYNNHPYVHVTVLDKLTYAGNRANIEAILGDRVELVVGDIADAELVDKLAAKADAIVHYAAESHNDNSLEDPSPFIHTNFIGTYTLLEAARKYDIRFHHVSTDEVYGDLPLREDLPGNGEGPGEKFTAETKYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRIGETYLIGADGEKNNKEVLELILEKMGQPKDAYDHVTDRAGHDLRYAIDSTKLREELGWEPQFTNFSEGLEETIKWYTENETWWKAEKDAVEAKYAKTQEVIK

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DAU_G_7(1KER)
?
[Raw transfer]




DAU_F_6(1KER)
?
[Raw transfer]




NAD_G_7(1KEP)
RMLB_STRMU
[Raw transfer]




NAD_F_6(1KEP)
RMLB_STRMU
[Raw transfer]




NAD_H_8(1KER)
?
[Raw transfer]




NAD_A_2(1R6D)
?
[Raw transfer]




NAD_A_4(1OC2)
?
[Raw transfer]




NAD_E_5(1KET)
RMLB_STRMU
[Raw transfer]




NAD_A_4(1OC2)
?
[Raw transfer]




NAD_F_6(1KET)
RMLB_STRMU
[Raw transfer]




NAD_I_9(1KER)
?
[Raw transfer]




NAD_A_2(1R6D)
?
[Raw transfer]




NAD_F_6(1KEU)
RMLB_SALTY
[Raw transfer]




NAD_F_6(1KEW)
RMLB_SALTY
[Raw transfer]




NAD_E_5(1KEW)
RMLB_SALTY
[Raw transfer]




NAD_A_3(1R66)
?
[Raw transfer]




NAD_D_4(2HUN)
?
[Raw transfer]




NAD_E_5(1KEW)
RMLB_SALTY
[Raw transfer]




NAD_E_5(1KEU)
RMLB_SALTY
[Raw transfer]




NAD_C_3(2HUN)
?
[Raw transfer]




NAD_B_4(1BXK)
RMLB2_ECOLI
[Raw transfer]




NAD_C_3(2HUN)
?
[Raw transfer]




NAD_A_3(1BXK)
RMLB2_ECOLI
[Raw transfer]




1 PsiBlast_PDB 96.4994% -71 - C1 -1KEP 12.6 RMLB_STRMU
22 PsiBlast_CBE 95.9494% -71 - C1 -1KET 12.4 RMLB_STRMU
3 PsiBlast_PDB 95.8894% -72 - C1 -1KET 12.6 RMLB_STRMU
24 PsiBlast_CBE 95.6994% -70 - C1 -1KEP 12.4 RMLB_STRMU
2 PsiBlast_PDB 95.5394% -70 - C1 -1KER 12.6 ?
32 HHSearch 95.0794% -69 - C1 -1OC2 12.1 ?
4 PsiBlast_PDB 95.0794% -69 - C1 -1OC2 12.1 ?
23 PsiBlast_CBE 94.7694% -68 - C1 -1KER 12.7 ?
21 PsiBlast_CBE 78.5794% -13 - C- -1OC2 - ? -
5 PsiBlast_PDB 74.5648% -79 - C1 -2HUN 10.2 ?
25 PsiBlast_CBE 73.9448% -71 - C1 -2HUN 10.8 ?
34 HHSearch 73.5149% -76 - C1 -2HUN 10.2 ?
8 PsiBlast_PDB 71.0844% -69 - C1 -1R66 10.6 ?
26 PsiBlast_CBE 70.8645% -72 - C1 -1BXK 11.8 RMLB2_ECOLI
7 PsiBlast_PDB 70.5545% -77 - C1 -1BXK 11.6 RMLB2_ECOLI
41 HHSearch 70.4545% -63 * C1 *1KEW 12.6 RMLB_SALTY
9 PsiBlast_PDB 70.3844% -66 - C1 -1R6D 10.7 ?
6 PsiBlast_PDB 69.9047% -71 - C1 -4EGB - ? -
27 PsiBlast_CBE 69.5343% -61 - C1 -1KEW 12.5 RMLB_SALTY
28 PsiBlast_CBE 69.4143% -60 - C1 -1KEU 12.2 RMLB_SALTY
12 PsiBlast_PDB 68.6143% -61 - C1 -1KEW 12.6 RMLB_SALTY
11 PsiBlast_PDB 68.1743% -60 - C1 -1KEU 12.2 RMLB_SALTY
33 HHSearch 68.0046% -60 - C1 -1R6D 10.7 ?