@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1423: (2015-12-07 )
MNKTIYDITIVGGGPVGLFAAFYAGLRGVSVKIIESLSELGGQPAILYPEKKIYDIPGYPVITGRELIDKHIEQLERFKDSIEICLKEEVLSFEKVDDVFTIQTDKDQHLSRAIVFACGNGAFAPRLLGLENEENYADNNLFYNVTKLEQFAGKHVVICGGGDSAVDWANELDKIAASVAIVHRRDAFRAHEHSVDILKASGVRILTPYVPIGLNGDSQRVSSLVVQKVKGDEVIELPLDNLIVSFGFSTSNKNLRYWNLDYKRSSINVSSLFETTQEGVYAIGDAANYPGKVELIATGYGEAPVAINQAINYIYPDRDNRVVHSTSLIK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FAD_B_6(3LZX)
FENR2_BACSU
[Raw transfer]




FAD_A_3(3AB1)
FENR_CHLTE
[Raw transfer]




FAD_B_4(3AB1)
FENR_CHLTE
[Raw transfer]




FAD_A_3(3AB1)
FENR_CHLTE
[Raw transfer]




FAD_A_2(3LZW)
FENR2_BACSU
[Raw transfer]




NAP_A_3(3LZW)
FENR2_BACSU
[Raw transfer]




NAP_A_4(3LZX)
FENR2_BACSU
[Raw transfer]




21 PsiBlast_CBE 92.6452%-120 - C1 -3LZX 13.6 FENR2_BACSU
1 PsiBlast_PDB 92.1752%-116 - C1 -3LZW 10.5 FENR2_BACSU
77 HHSearch 91.1552%-114 - C1 -3LZW 13.7 FENR2_BACSU
2 PsiBlast_PDB 91.1052%-118 - C1 -3LZX 10.2 FENR2_BACSU
3 PsiBlast_PDB 76.7938%-106 - C1 -3AB1 12.8 FENR_CHLTE
78 HHSearch 76.6437%-109 - C1 -2ZBW - FENR_THET8 -
79 HHSearch 75.5936%-112 - C1 -3AB1 12.9 FENR_CHLTE
22 PsiBlast_CBE 75.0838%-102 - C1 -3AB1 13.7 FENR_CHLTE
4 PsiBlast_PDB 72.1539%-108 - C1 -2ZBW - FENR_THET8 -
68 Fugue 69.5722%-112 - C1 -1HYU - AHPF_SALTY -
82 HHSearch 69.2724%-110 - C1 -1FL2 - AHPF_ECOLI -
81 HHSearch 67.8927%-112 - C1 -3R9U - ? -
88 HHSearch 67.4223%-111 - C1 -1HYU - AHPF_SALTY -
92 HHSearch 66.5326% -97 - C1 -1TRB - TRXB_ECOLI -
80 HHSearch 66.4625%-116 - C1 -3F8D - ? -
87 HHSearch 66.4428%-106 - C1 -2Q7V - ? -
10 PsiBlast_PDB 65.4526%-107 - C1 -3R9U - ? -
13 PsiBlast_PDB 64.3225%-117 - C1 -3F8R - ? -
12 PsiBlast_PDB 64.1025%-117 - C1 -3F8P - ? -
11 PsiBlast_PDB 63.9925%-116 - C1 -3F8D - ? -