@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1445: (2015-12-08 )
MSKQYDYIVIGGGSAGSGTANRAAMYGAKVLLIEGGQVGGTCVNLGCVPKKIMWYGAQVSETLHKYSSGYGFEVNNLNFDFTTLKANRDAYVQRSRQSYAANFERNGVEKIDGFARFIDNHTIEVNGQQYKAPHITIATGGHPLYPDIIGSELGETSDDFFGWETLPDSILIVGAGYIAAELAGVVNELGVETHLAFRKDHILRGFDDMVTSEVMAEMEKSGISLHANHVPKSLKRDEGGKLIFEAENGKTLVVDRVIWAIGRGPNVDMGLENTDIVLNDKGYIKTDEFENTSVDGVYAIGDVNGKIALTPVAIAAGRRLSERLFNHKDNEKLDYHNVPSVIFTHPVIGTVGLSEAAAIEQFGEDNIKVYTSTFTSMYTAVTTNRQAVKMKLITLGKEEKVIGLHGVGYGIDEMIQGFSVAIKMGATKADFDDTVAIHPTGSEEFVTMR

Atome Classification :

(65 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ELI_A_7(2GH5)
GSHR_HUMAN
[Raw transfer]




FAD_B_10(2GH5)
GSHR_HUMAN
[Raw transfer]




FAD_A_3(3SQP)
GSHR_HUMAN
[Raw transfer]




FAD_B_7(4J57)
TRXR2_PLAF7
[Raw transfer]




FAD_A_3(1GET)
GSHR_ECOLI
[Raw transfer]




FAD_A_5(3DK9)
GSHR_HUMAN
[Raw transfer]




FAD_A_5(3DK9)
GSHR_HUMAN
[Raw transfer]




FAD_B_8(3SQP)
GSHR_HUMAN
[Raw transfer]




FAD_C_3(1ZDL)
TRXR2_MOUSE
[Raw transfer]




FAD_A_2(3H4K)
?
[Raw transfer]




FAD_B_5(1GET)
GSHR_ECOLI
[Raw transfer]




FAD_B_10(2R9Z)
GASHR_MARGR
[Raw transfer]




FAD_A_4(3DK8)
GSHR_HUMAN
[Raw transfer]




FAD_A_3(3DK4)
GSHR_HUMAN
[Raw transfer]




FAD_A_11(3DJJ)
GSHR_HUMAN
[Raw transfer]




FAD_X_2(3DJG)
GSHR_HUMAN
[Raw transfer]




ELI_B_8(2GH5)
GSHR_HUMAN
[Raw transfer]




FAD_B_5(1GEU)
GSHR_ECOLI
[Raw transfer]




FAD_A_9(2GH5)
GSHR_HUMAN
[Raw transfer]




FAD_E_5(1GRB)
GSHR_HUMAN
[Raw transfer]




FAD_E_5(1GRF)
GSHR_HUMAN
[Raw transfer]




FAD_C_3(4GRT)
GSHR_HUMAN
[Raw transfer]




FAD_E_5(1GRE)
GSHR_HUMAN
[Raw transfer]




FAD_A_3(3DGH)
TRXR1_DROME
[Raw transfer]




FAD_C_3(1ONF)
GSHR_PLAFK
[Raw transfer]




FAD_A_3(1GEU)
GSHR_ECOLI
[Raw transfer]




FAD_A_2(2V6O)
?
[Raw transfer]




FAD_B_4(1GER)
GSHR_ECOLI
[Raw transfer]




FAD_B_4(4B1B)
TRXR_PLAF5
[Raw transfer]




FAD_A_3(1GES)
GSHR_ECOLI
[Raw transfer]




FAD_A_3(2X50)
?
[Raw transfer]




FAD_A_3(2X8C)
?
[Raw transfer]




FAD_A_3(1BWC)
GSHR_HUMAN
[Raw transfer]




FAD_A_5(3O0H)
?
[Raw transfer]




FAD_A_2(2X8G)
?
[Raw transfer]




FAD_A_8(2AAQ)
GSHR_HUMAN
[Raw transfer]




FAD_A_3(1GER)
GSHR_ECOLI
[Raw transfer]




FAD_C_3(1ONF)
GSHR_PLAFK
[Raw transfer]




FAD_A_2(2X99)
?
[Raw transfer]




FAD_C_3(1GRT)
GSHR_HUMAN
[Raw transfer]




FAD_A_3(2R9Z)
GASHR_MARGR
[Raw transfer]




FAD_A_3(2R9Z)
GASHR_MARGR
[Raw transfer]




FAD_A_2(2X8H)
?
[Raw transfer]




FAD_C_3(2NVK)
TRXR1_DROME
[Raw transfer]




FAD_A_5(4J57)
TRXR2_PLAF7
[Raw transfer]




FAD_C_3(1XAN)
GSHR_HUMAN
[Raw transfer]




FAD_C_3(1ZKQ)
TRXR2_MOUSE
[Raw transfer]




FAD_C_3(2GRT)
GSHR_HUMAN
[Raw transfer]




FAD_E_5(4GR1)
GSHR_HUMAN
[Raw transfer]




FAD_A_3(1FEC)
TYTR_CRIFA
[Raw transfer]




FAD_C_3(1GRA)
GSHR_HUMAN
[Raw transfer]




FAD_A_3(4B1B)
TRXR_PLAF5
[Raw transfer]




FAD_E_5(3GRS)
GSHR_HUMAN
[Raw transfer]




FAD_A_3(1GER)
GSHR_ECOLI
[Raw transfer]




FAD_A_3(1GES)
GSHR_ECOLI
[Raw transfer]




FAD_B_8(2X50)
?
[Raw transfer]




FAD_A_3(3DH9)
TRXR1_DROME
[Raw transfer]




FAD_B_4(1GES)
GSHR_ECOLI
[Raw transfer]




FAD_A_5(3O0H)
?
[Raw transfer]




FAD_B_6(3DGH)
TRXR1_DROME
[Raw transfer]




FAD_B_4(3DH9)
TRXR1_DROME
[Raw transfer]




FAD_C_3(3GRT)
GSHR_HUMAN
[Raw transfer]




QUM_B_9(1GXF)
TYTR_TRYCR
[Raw transfer]




QUM_A_6(1GXF)
TYTR_TRYCR
[Raw transfer]




ACM_G_7(1GRF)
GSHR_HUMAN
[Raw transfer]




AJ3_A_4(1BWC)
GSHR_HUMAN
[Raw transfer]




NDP_B_16(2WBA)
TYTR_TRYBB
[Raw transfer]




NDP_A_8(2WBA)
TYTR_TRYBB
[Raw transfer]




TS4_E_5(5GRT)
GSHR_HUMAN
[Raw transfer]




22 PsiBlast_CBE 92.6155% -87 - C1 -1GER 13.7 GSHR_ECOLI
11 PsiBlast_PDB 92.5150% -92 - C1 -1BWC 12.6 GSHR_HUMAN
101 HHSearch 91.8255% -90 - C1 -1GES 13.6 GSHR_ECOLI
23 PsiBlast_CBE 91.1954% -87 - C1 -1GEU 13.5 GSHR_ECOLI
1 PsiBlast_PDB 91.1855% -87 - C1 -1GER 13.7 GSHR_ECOLI
21 PsiBlast_CBE 90.4555% -86 - C1 -1GET 13.5 GSHR_ECOLI
24 PsiBlast_CBE 90.4454% -87 - C1 -1GES 13.7 GSHR_ECOLI
3 PsiBlast_PDB 89.7354% -88 - C1 -1GES 13.6 GSHR_ECOLI
2 PsiBlast_PDB 89.5755% -88 - C1 -1GET 13.3 GSHR_ECOLI
12 PsiBlast_PDB 89.0450% -91 - C1 -2GH5 13.4 GSHR_HUMAN
31 PsiBlast_CBE 88.8650% -89 - C1 -1XAN 13.6 GSHR_HUMAN
20 PsiBlast_PDB 88.8250% -91 - C1 -3DK4 13.6 GSHR_HUMAN
114 HHSearch 88.5351% -86 - C1 -3DK9 13.4 GSHR_HUMAN
4 PsiBlast_PDB 87.8354% -87 - C1 -1GEU 13.0 GSHR_ECOLI
28 PsiBlast_CBE 87.7650% -89 - C1 -3DK8 13.6 GSHR_HUMAN
25 PsiBlast_CBE 87.7550% -87 - C1 -3SQP 12.9 GSHR_HUMAN
29 PsiBlast_CBE 87.6550% -88 - C1 -3DJG 13.0 GSHR_HUMAN
26 PsiBlast_CBE 87.6150% -87 - C1 -3SQP 13.0 GSHR_HUMAN
9 PsiBlast_PDB 87.5950% -87 - C1 -5GRT 2.3 GSHR_HUMAN
13 PsiBlast_PDB 87.5350% -90 - C1 -1GRA 13.2 GSHR_HUMAN
14 PsiBlast_PDB 87.4550% -88 - C1 -1GRB 12.8 GSHR_HUMAN
30 PsiBlast_CBE 87.3250% -88 - C1 -2GH5 13.4 GSHR_HUMAN
27 PsiBlast_CBE 87.2650% -87 - C1 -3DK9 13.4 GSHR_HUMAN
17 PsiBlast_PDB 87.1250% -87 - C1 -3GRS 13.2 GSHR_HUMAN
5 PsiBlast_PDB 87.0250% -86 - C1 -1GRT 12.7 GSHR_HUMAN
19 PsiBlast_PDB 87.0050% -87 - C1 -3DJJ 13.2 GSHR_HUMAN
16 PsiBlast_PDB 86.9550% -89 - C1 -1GRF 13.2 GSHR_HUMAN
18 PsiBlast_PDB 86.5750% -89 - C1 -4GR1 13.0 GSHR_HUMAN
6 PsiBlast_PDB 86.5450% -87 - C1 -2GRT 12.4 GSHR_HUMAN
15 PsiBlast_PDB 86.4750% -88 - C1 -1GRE 12.8 GSHR_HUMAN
7 PsiBlast_PDB 86.4750% -88 - C1 -3GRT 12.9 GSHR_HUMAN
10 PsiBlast_PDB 85.9450% -87 - C1 -2AAQ 12.0 GSHR_HUMAN
32 PsiBlast_CBE 84.2346% -82 - C1 -2R9Z 12.5 GASHR_MARGR
123 Fugue 83.8952% -86 - C1 -1GER 12.7 GSHR_ECOLI
117 HHSearch 83.5647% -83 - C1 -2R9Z 12.9 GASHR_MARGR
8 PsiBlast_PDB 83.3850% -86 - C1 -4GRT 11.4 GSHR_HUMAN
33 PsiBlast_CBE 82.2746% -82 - C1 -2R9Z 12.9 GASHR_MARGR
93 PsiBlast_CBE 77.1935% -85 - C1 -1ZKQ 11.7 TRXR2_MOUSE
105 HHSearch 76.5542% -85 - C1 -1ONF 10.1 GSHR_PLAFK
39 PsiBlast_CBE 75.7736% -85 - C1 -3DGH 13.3 TRXR1_DROME
38 PsiBlast_CBE 75.1336% -85 - C1 -3DGH 12.9 TRXR1_DROME
34 PsiBlast_CBE 74.9837% -91 - C1 -1ONF 10.0 GSHR_PLAFK
46 PsiBlast_CBE 73.8033% -98 - C1 -4B1B 12.5 TRXR_PLAF5
113 HHSearch 73.6734% -82 * C1 *1FEC 13.4 TYTR_CRIFA
86 PsiBlast_CBE 73.5536% -90 - C1 -2X8H 13.6 ?
35 PsiBlast_CBE 73.3736% -85 - C1 -2NVK 13.6 TRXR1_DROME
47 PsiBlast_CBE 73.1833% -95 - C1 -4B1B 12.1 TRXR_PLAF5
36 PsiBlast_CBE 72.6436% -81 - C1 -3DH9 13.4 TRXR1_DROME
40 PsiBlast_CBE 72.6033% -96 - C1 -4J57 12.8 TRXR2_PLAF7
41 PsiBlast_CBE 72.3533% -95 - C1 -4J57 12.5 TRXR2_PLAF7
49 PsiBlast_CBE 72.2934% -82 - C1 -2WBA 5.0 TYTR_TRYBB
98 PsiBlast_CBE 72.1533% -78 - C1 -1GXF 3.7 TYTR_TRYCR
87 PsiBlast_CBE 72.0536% -89 - C1 -2X8G 13.4 ?
90 PsiBlast_CBE 71.9336% -87 - C1 -3H4K 12.9 ?
97 PsiBlast_CBE 71.2833% -80 - C1 -1GXF 2.8 TYTR_TRYCR
85 PsiBlast_CBE 71.0936% -85 - C1 -2X99 13.3 ?
94 PsiBlast_CBE 70.9635% -79 - C1 -1ZDL 12.9 TRXR2_MOUSE
84 PsiBlast_CBE 70.9336% -88 - C1 -2V6O 13.3 ?
48 PsiBlast_CBE 70.7834% -80 - C1 -2WBA 5.4 TYTR_TRYBB
37 PsiBlast_CBE 70.7536% -82 - C1 -3DH9 13.5 TRXR1_DROME
104 HHSearch 70.5436% -87 - C1 -3O0H 12.8 ?
89 PsiBlast_CBE 69.8136% -90 - C1 -2X8C 13.2 ?
99 PsiBlast_CBE 69.4233% -82 - C1 -2X50 12.6 ?
91 PsiBlast_CBE 69.3835% -85 - C1 -3O0H 12.6 ?
100 PsiBlast_CBE 68.0033% -82 - C1 -2X50 12.8 ?