@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1448: (2015-12-08 )
MQVEVDLPNHSYHIKIEEGCFSEAGDWVSHLWQKQMITIITDSNVEILYGESLVNQLKKQGFTVHVFSFAAGEASKTLEVANRIYGFLAKHHMTRSDGIIALGGGVVGDLAAFVASTYMRGIHFLQIPTSLTAQVDSSIGGKTGVNTSFAKNMVGTFAQPDGVLIDPVTLKTLGNRELVEGMGEVIKYGLIDDIKLWHILEEMDGTIDSILDSALAIIYHSCQVKRKHVLADQYDKGLRMHLNFGHTIGHAIEVHAGYGEIMHGEAVAIGMIQLSRVAERKNLMPRGISQDIYNMCLKFGLPVHYAEWDKDVLFDILSHDKKASGQFIKIVILPQLGSATVHQIPLEEMRDYLEK

Atome Classification :

(33 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_B_12(3OKF)
AROB_VIBCH
[Raw transfer]




NAD_A_3(3OKF)
AROB_VIBCH
[Raw transfer]




NAD_A_3(3OKF)
AROB_VIBCH
[Raw transfer]




NAD_A_5(1SG6)
ARO1_EMENI
[Raw transfer]




NAD_A_19(1NRX)
ARO1_EMENI
[Raw transfer]




NAD_A_8(1NR5)
ARO1_EMENI
[Raw transfer]




NAD_A_6(1DQS)
ARO1_EMENI
[Raw transfer]




NAD_A_7(1NVB)
ARO1_EMENI
[Raw transfer]




NAD_B_8(1DQS)
ARO1_EMENI
[Raw transfer]




NAD_B_9(1NR5)
ARO1_EMENI
[Raw transfer]




NAD_A_5(1SG6)
ARO1_EMENI
[Raw transfer]




NAD_A_6(1DQS)
ARO1_EMENI
[Raw transfer]




NAD_A_8(1XAG)
AROB_STAAR
[Raw transfer]




NAD_B_6(1SG6)
ARO1_EMENI
[Raw transfer]




NAD_B_20(1NRX)
ARO1_EMENI
[Raw transfer]




NAD_B_6(1XAH)
AROB_STAAR
[Raw transfer]




CRB_B_6(1XAI)
AROB_STAAR
[Raw transfer]




NAD_A_5(1XAH)
AROB_STAAR
[Raw transfer]




NAD_A_5(1XAH)
AROB_STAAR
[Raw transfer]




CRB_A_6(1NVD)
ARO1_EMENI
[Raw transfer]




CRB_A_9(1XAG)
AROB_STAAR
[Raw transfer]




CRB_C_16(1NVF)
ARO1_EMENI
[Raw transfer]




CRB_B_7(1NVD)
ARO1_EMENI
[Raw transfer]




CRB_A_14(1NVF)
ARO1_EMENI
[Raw transfer]




CRB_B_15(1NVF)
ARO1_EMENI
[Raw transfer]




21 PsiBlast_CBE 97.2039%-111 - C3 -3OKF 8.6 AROB_VIBCH
49 HHSearch 96.8538%-110 - C3 -3OKF 8.6 AROB_VIBCH
1 PsiBlast_PDB 95.8539%-107 - C3 -3OKF 8.6 AROB_VIBCH
53 HHSearch 90.9636%-106 * C3 *1SG6 8.9 ARO1_EMENI
39 Fugue 89.6534%-102 - C3 -1DQS 9.7 ARO1_EMENI
23 PsiBlast_CBE 89.6337%-102 - C3 -3ZOK - DHQS_ACTCH -
2 PsiBlast_PDB 89.0237%-101 - C3 -3ZOK - DHQS_ACTCH -
22 PsiBlast_CBE 88.0137%-105 - C3 -3ZOK - DHQS_ACTCH -
24 PsiBlast_CBE 87.7737%-103 - C3 -3ZOK - DHQS_ACTCH -
54 HHSearch 85.0228%-101 - C3 -3QBE - AROB_MYCTU -
27 PsiBlast_CBE 84.7134%-109 - C3 -1SG6 8.5 ARO1_EMENI
11 PsiBlast_PDB 84.5234%-108 - C3 -1NVA - ARO1_EMENI -
36 PsiBlast_CBE 84.5034%-109 - C3 -1NRX 5.4 ARO1_EMENI
15 PsiBlast_PDB 84.3934%-108 - C3 -1SG6 8.9 ARO1_EMENI
3 PsiBlast_PDB 84.2931% -95 - C3 -1XAG 7.8 AROB_STAAR
50 HHSearch 84.2531%-108 - C3 -1XAH 7.4 AROB_STAAR
35 PsiBlast_CBE 84.2534%-106 - C3 -1NUA - ARO1_EMENI -
48 HHSearch 84.1927% -99 - C3 -2GRU - DOIS_BACCI -
26 PsiBlast_CBE 84.1531%-103 - C3 -1XAH 8.2 AROB_STAAR
10 PsiBlast_PDB 84.0034%-109 - C3 -1NUA - ARO1_EMENI -
9 PsiBlast_PDB 83.8034%-111 - C3 -1NRX 5.9 ARO1_EMENI
13 PsiBlast_PDB 83.1434% -96 - C3 -1NVD 5.3 ARO1_EMENI
32 PsiBlast_CBE 82.7734% -95 - C3 -1NVD 5.2 ARO1_EMENI
7 PsiBlast_PDB 82.4834% -93 - C3 -1DQS 9.8 ARO1_EMENI
4 PsiBlast_PDB 82.0431% -99 - C3 -1XAH 7.5 AROB_STAAR
12 PsiBlast_PDB 81.8534% -93 - C3 -1NVB 7.0 ARO1_EMENI
8 PsiBlast_PDB 81.6034% -93 - C3 -1NR5 9.5 ARO1_EMENI
37 PsiBlast_CBE 81.4434% -93 - C3 -1NR5 8.8 ARO1_EMENI
28 PsiBlast_CBE 81.3134% -98 - C3 -1NVF 6.0 ARO1_EMENI
38 PsiBlast_CBE 81.2834% -94 - C3 -1DQS 9.8 ARO1_EMENI
14 PsiBlast_PDB 81.2834% -97 - C3 -1NVF 4.4 ARO1_EMENI
25 PsiBlast_CBE 81.2431% -88 - C3 -1XAI 4.4 AROB_STAAR
29 PsiBlast_CBE 81.0434% -98 - C3 -1NVF 5.3 ARO1_EMENI