@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1501: (2015-12-08 )
MSKKIILGILSLLSVVTLVACGSSDKQLQDKVEKKGKLVLAVSPDYAPFEFKALVNGKDKVVGADIELAQAIADELHVKLEVSPMSFDNVLSSLQTGKADMAISGLSYTKERAKVYDFSKPYYTTENAVLVRKSDLGKYTSIESLKGKKIAVQKGSIEEGVSKKSFKNSHVVSLTAMGEAISELKSGKVEAVDLEKPVAEGYLAQNPDLVLAKFALKTGEGDAKAVALPKDSGKMLKTVNKVIKRLEKEDKYKVYISDAAKLTGNQVE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ARG_A_21(4H5F)
?
[Raw transfer]




ARG_B_17(4H5G)
?
[Raw transfer]




ARG_A_12(4H5G)
?
[Raw transfer]




2 PsiBlast_PDB 97.5853% -75 - C1 -4H5F 5.2 ?
3 PsiBlast_PDB 96.7153% -75 - C1 -4H5G 5.4 ?
21 PsiBlast_CBE 96.6053% -74 - C1 -4H5G 5.1 ?
24 PsiBlast_CBE 96.2853% -74 - C1 -4H5F - ? -
23 PsiBlast_CBE 96.1353% -74 - C1 -4H5F - ? -
1 PsiBlast_PDB 79.6148% -57 - C- -4I62 - ? -
6 PsiBlast_PDB 79.4734% -68 - C1 -4PSH - ? -
26 PsiBlast_CBE 79.4334% -68 - C1 -4PSH - ? -
4 PsiBlast_PDB 78.7136% -68 - C1 -4YMX - ? -
25 PsiBlast_CBE 78.5436% -66 - C1 -4YMX - ? -
44 HHSearch 77.2727% -64 - C1 -2Y7I - ? -
36 HHSearch 76.2024% -51 - C1 -2YJP - ? -
9 PsiBlast_PDB 75.2527% -72 - C1 -2Y7I - ? -
5 PsiBlast_PDB 74.4434% -73 - C1 -4PRS - ? -
8 PsiBlast_PDB 74.3531% -81 - C1 -1WDN - GLNH_ECOLI -
43 HHSearch 73.3528% -62 - C1 -2PVU - ? -
59 Fugue 72.9127% -64 - C1 -4P0G - MLTF_PSEAE -
63 Fugue 72.6825% -41 - C1 -4Z9N - ? -
45 HHSearch 72.1426% -52 - C1 -1LST - ARGT_SALTY -
49 HHSearch 72.0324% -53 - C1 -1XT8 - ? -