@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1573: (2015-12-09 )
MLVCNHVGKTFGRQEVLKDCHFHLKRGEIIGIMGKSGSGKSSLARLIIGLDSPTCGSIHFQGKNYTPKDGRAQIILVFQDALSSVNPYFSIEEILNEAFYGKKTTFELCQILEAVGLDGTYLKYKARQLSGGQLQRVCIARALLLKPKIIIFDESLSGLDPVTQIKMLHLLQKIKRRYELSFIMISHDPKICQAICNRVFLIKNGYLVEDNEFLKRACSTNCLTNL

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_5(1L2T)
Y796_METJA
[Raw transfer]




ADP_B_8(3TIF)
Y796_METJA
[Raw transfer]




ADP_A_3(3TIF)
Y796_METJA
[Raw transfer]




92 HHSearch 94.3833%-142 - C1 -3TUI - METN_ECOLI -
75 Fugue 94.3533%-131 - C1 -3TUZ - METN_ECOLI -
17 PsiBlast_PDB 88.4632%-150 - C1 -4YMS - ? -
31 PsiBlast_CBE 86.6032%-150 - C1 -4YMV - ? -
32 PsiBlast_CBE 86.4632%-148 - C1 -4YMU - ? -
18 PsiBlast_PDB 86.4032%-148 - C1 -4YMT - ? -
19 PsiBlast_PDB 86.3632%-148 - C1 -4YMU - ? -
20 PsiBlast_PDB 86.1632%-152 - C1 -4YMV - ? -
26 PsiBlast_CBE 85.1334%-130 - C1 -3TUI - METN_ECOLI -
3 PsiBlast_PDB 85.0534%-137 - C1 -3TUZ - METN_ECOLI -
2 PsiBlast_PDB 84.9834%-132 - C1 -3TUI - METN_ECOLI -
22 PsiBlast_CBE 84.4434%-134 - C1 -3TUZ - METN_ECOLI -
21 PsiBlast_CBE 84.4334%-136 - C1 -3TUZ - METN_ECOLI -
24 PsiBlast_CBE 84.0034%-132 - C1 -3TUI - METN_ECOLI -
25 PsiBlast_CBE 83.9034%-131 - C1 -3TUI - METN_ECOLI -
23 PsiBlast_CBE 83.8534%-134 - C1 -3TUZ - METN_ECOLI -
1 PsiBlast_PDB 83.8235%-133 - C1 -3DHW - METN_ECOLI -
40 PsiBlast_CBE 82.7231%-136 - C1 -1L2T 6.5 Y796_METJA
41 PsiBlast_CBE 82.1631%-140 - C1 -3TIF 6.2 Y796_METJA
39 PsiBlast_CBE 82.1331%-138 - C1 -1L2T - Y796_METJA -
42 PsiBlast_CBE 81.9031%-139 - C1 -3TIF 6.0 Y796_METJA