@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1626: (2015-12-09 )
MKKGLMISFEGPDGAGKTTVLEAVLPLLREKLSQDILTTREPGGVTISEEIRHIILDVKHTQMDKKTELLLYMAARRQHLVEKVLPALEEGKIVLMDRFIDSSVAYQGSGRGLDKSHIKWLNDYATDSHKPDLTLYFDVPSEVGLERIQKSVQREVNRLDLEQLDMHQRVRQGYLELADSEPNRIVTIDASQQLDEVIAETFSIILDRINQ

Atome Classification :

(50 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

T5A_A_2(4TMK)
KTHY_ECOLI
[Raw transfer]




16T_B_4(4HLD)
KTHY_STAAR
[Raw transfer]




32K_B_4(4QG7)
KTHY_STAAR
[Raw transfer]




TYD_B_7(3HJN)
KTHY_THEMA
[Raw transfer]




16T_A_3(4HLD)
KTHY_STAAR
[Raw transfer]




ATM_A_5(4GMD)
KTHY_PSEAE
[Raw transfer]




13Y_B_4(4HDC)
KTHY_STAAN
[Raw transfer]




32C_B_4(4QGG)
KTHY_STAAR
[Raw transfer]




T05_B_4(4HLC)
KTHY_STAAR
[Raw transfer]




ATM_D_15(4GMD)
KTHY_PSEAE
[Raw transfer]




32K_A_3(4QG7)
KTHY_STAAR
[Raw transfer]




32B_A_3(4QGF)
KTHY_STAAR
[Raw transfer]




ATM_B_8(4GMD)
KTHY_PSEAE
[Raw transfer]




32C_A_3(4QGG)
KTHY_STAAR
[Raw transfer]




ATM_B_4(4EAQ)
KTHY_STAAM
[Raw transfer]




31Z_B_4(4QGA)
KTHY_STAAR
[Raw transfer]




TYD_A_4(3HJN)
KTHY_THEMA
[Raw transfer]




TYD_A_4(3HJN)
KTHY_THEMA
[Raw transfer]




13Y_A_3(4HDC)
KTHY_STAAN
[Raw transfer]




32E_B_4(4QGH)
KTHY_STAAR
[Raw transfer]




31Z_A_3(4QGA)
KTHY_STAAR
[Raw transfer]




T05_A_3(4HLC)
KTHY_STAAR
[Raw transfer]




TMP_A_3(2CCG)
KTHY_STAAM
[Raw transfer]




THM_A_4(3N2I)
KTHY_VIBCH
[Raw transfer]




ATM_C_12(4GMD)
KTHY_PSEAE
[Raw transfer]




43N_A_3(4XWA)
KTHY_STAA1
[Raw transfer]




ATM_A_3(4EAQ)
KTHY_STAAM
[Raw transfer]




43N_B_4(4XWA)
KTHY_STAA1
[Raw transfer]




TMP_B_4(2CCG)
KTHY_STAAM
[Raw transfer]




32E_A_3(4QGH)
KTHY_STAAR
[Raw transfer]




THM_B_6(3N2I)
KTHY_VIBCH
[Raw transfer]




0Y5_A_3(4GSY)
KTHY_STAAR
[Raw transfer]




TMP_A_6(2CCJ)
KTHY_STAAM
[Raw transfer]




0DJ_B_4(3UWO)
KTHY_PSEAE
[Raw transfer]




0YB_A_3(4GFD)
KTHY_STAAM
[Raw transfer]




0DJ_A_3(3UWO)
KTHY_PSEAE
[Raw transfer]




0DF_B_5(3UWK)
KTHY_PSEAE
[Raw transfer]




14D_A_3(4HEJ)
KTHY_STAAN
[Raw transfer]




THM_A_2(4ESH)
KTHY_PSEAE
[Raw transfer]




0DN_C_11(3UXM)
KTHY_PSEAE
[Raw transfer]




0DN_B_8(3UXM)
KTHY_PSEAE
[Raw transfer]




0DN_A_7(3UXM)
KTHY_PSEAE
[Raw transfer]




0DF_A_3(3UWK)
KTHY_PSEAE
[Raw transfer]




0DN_D_12(3UXM)
KTHY_PSEAE
[Raw transfer]




ADP_A_4(4EDH)
KTHY_PSEAE
[Raw transfer]




MRD_A_3(3V9P)
KTHY_BURTA
[Raw transfer]




MES_A_3(4MQB)
KTHY_STAAM
[Raw transfer]




ADP_B_9(4EDH)
KTHY_PSEAE
[Raw transfer]




ADP_A_2(3LV8)
KTHY_VIBCH
[Raw transfer]




ADP_A_2(3LV8)
KTHY_VIBCH
[Raw transfer]




8 PsiBlast_PDB 87.5547% -87 - C1 -4HEJ 7.7 KTHY_STAAN
29 PsiBlast_CBE 86.8647% -88 - C1 -4QGH 8.9 KTHY_STAAR
21 PsiBlast_CBE 86.8147% -88 - C1 -4EAQ 6.8 KTHY_STAAM
35 PsiBlast_CBE 86.7547% -85 - C1 -4HDC 9.3 KTHY_STAAN
30 PsiBlast_CBE 86.7147% -86 - C1 -4QGG 9.9 KTHY_STAAR
34 PsiBlast_CBE 86.6347% -85 - C1 -4HLC 8.5 KTHY_STAAR
31 PsiBlast_CBE 86.5447% -82 - C1 -4QGA 8.2 KTHY_STAAR
32 PsiBlast_CBE 86.4947% -83 - C1 -4QG7 8.1 KTHY_STAAR
16 PsiBlast_PDB 86.3547% -83 - C1 -4XWA 8.5 KTHY_STAA1
4 PsiBlast_PDB 86.3547% -88 - C1 -2CCJ 5.5 KTHY_STAAM
14 PsiBlast_PDB 86.2547% -83 - C1 -4QGG 9.9 KTHY_STAAR
37 PsiBlast_CBE 86.1940% -83 - C1 -4GMD 5.8 KTHY_PSEAE
9 PsiBlast_PDB 85.9047% -85 - C1 -4HLC 8.5 KTHY_STAAR
6 PsiBlast_PDB 85.8747% -88 - C1 -4GSY 8.8 KTHY_STAAR
10 PsiBlast_PDB 85.8547% -83 - C1 -4HLD 8.5 KTHY_STAAR
28 PsiBlast_CBE 85.7947% -90 - C1 -4XWA 9.2 KTHY_STAA1
11 PsiBlast_PDB 85.7047% -81 - C1 -4QG7 8.2 KTHY_STAAR
33 PsiBlast_CBE 85.6447% -84 - C1 -4HLD 8.1 KTHY_STAAR
2 PsiBlast_PDB 85.5947% -85 - C1 -4EAQ 6.2 KTHY_STAAM
18 PsiBlast_PDB 85.5747% -86 - C1 -4MQB 2.4 KTHY_STAAM
5 PsiBlast_PDB 85.4647% -89 - C1 -4GFD 9.6 KTHY_STAAM
15 PsiBlast_PDB 85.4447% -82 - C1 -4QGH 9.1 KTHY_STAAR
7 PsiBlast_PDB 85.3547% -84 - C1 -4HDC 9.2 KTHY_STAAN
13 PsiBlast_PDB 85.3147% -82 - C1 -4QGF 8.7 KTHY_STAAR
41 PsiBlast_CBE 85.2740% -73 - C1 -4EDH 6.8 KTHY_PSEAE
19 PsiBlast_PDB 85.1040% -75 - C1 -4EDH 7.1 KTHY_PSEAE
12 PsiBlast_PDB 85.0347% -83 - C1 -4QGA 8.9 KTHY_STAAR
38 PsiBlast_CBE 84.8840% -81 - C1 -4GMD 5.2 KTHY_PSEAE
36 PsiBlast_CBE 84.7647% -80 - C1 -2CCG 5.8 KTHY_STAAM
17 PsiBlast_PDB 83.9247% -82 - C1 -2CCG 6.3 KTHY_STAAM
39 PsiBlast_CBE 83.7240% -80 - C1 -4GMD 5.8 KTHY_PSEAE
20 PsiBlast_PDB 83.4740% -78 - C1 -4ESH 3.8 KTHY_PSEAE
46 PsiBlast_CBE 83.2440% -79 - C1 -3UWO 4.9 KTHY_PSEAE
47 PsiBlast_CBE 82.8040% -79 - C1 -3UWO 4.4 KTHY_PSEAE
48 PsiBlast_CBE 81.9340% -81 - C1 -3UWK 5.0 KTHY_PSEAE
40 PsiBlast_CBE 81.3040% -74 - C1 -4GMD 5.0 KTHY_PSEAE
43 PsiBlast_CBE 81.2340% -79 - C1 -3UXM 4.5 KTHY_PSEAE
44 PsiBlast_CBE 81.2040% -70 - C1 -3UXM 4.6 KTHY_PSEAE
45 PsiBlast_CBE 80.2240% -83 - C1 -3UXM 4.0 KTHY_PSEAE
42 PsiBlast_CBE 80.1640% -71 - C1 -3UXM 3.7 KTHY_PSEAE
59 PsiBlast_CBE 79.5239% -77 - C1 -3N2I 5.9 KTHY_VIBCH
49 PsiBlast_CBE 78.8140% -70 - C1 -3UWK 4.4 KTHY_PSEAE
60 PsiBlast_CBE 78.2239% -80 - C1 -3N2I 5.5 KTHY_VIBCH
61 PsiBlast_CBE 78.0439% -79 - C1 -3LV8 6.3 KTHY_VIBCH
81 Fugue 76.4838% -73 - C1 -4TMK 11.0 KTHY_ECOLI
95 HHSearch 75.7036% -72 - C1 -3LV8 6.3 KTHY_VIBCH
92 HHSearch 75.3937% -72 - C1 -3V9P 3.1 KTHY_BURTA
101 HHSearch 74.5441% -75 * C1 *3HJN 6.5 KTHY_THEMA
53 PsiBlast_CBE 71.4743% -67 - C1 -3HJN 5.6 KTHY_THEMA
52 PsiBlast_CBE 69.2743% -69 - C1 -3HJN 6.4 KTHY_THEMA