@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1689: (2015-12-09 )
MTIKKVLSVTGIILVTVASLAACSSKSHTTKTGKKEVNFATVGTTAPFSYVKDGKLTGFDIEVAKAVFKGSDNYKVTFKKTEWSSVFTGIDSGKFQMGGNNISYSSERSQKYLFSYPIGSTPSVLAVPKNSNIKAYNDITGHKTQVVQGTTTAKQLENFNKKHQKNPVTLKYTNENITQILTNLSDGKADFKLFDGLTVNAIIKNQGLTNLKTIPLTMRDQPYIYFIFGQDQKDLQKYVNNCLKQLRKDGTLSKIAKEYLGGDYVPNEKDLVTPKEK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GDS_B_(4C0R)
?
[Raw transfer]




GSH_A_2(4EQ9)
?
[Raw transfer]




21 PsiBlast_CBE 98.2559% -94 - C1 -4C0R 7.3 ?
1 PsiBlast_PDB 95.9548% -93 - C1 -4EQ9 5.3 ?
69 Fugue 77.3619% -74 - C1 -4P0G - MLTF_PSEAE -
50 HHSearch 74.9230% -71 - C1 -2YLN - ? -
45 HHSearch 73.8824% -72 - C1 -2YJP - ? -
5 PsiBlast_PDB 73.5930% -77 - C1 -2Q2C - ? -
52 HHSearch 72.4023% -66 - C1 -1WDN - GLNH_ECOLI -
61 HHSearch 72.2821% -67 * C1 *3VV5 - ? -
6 PsiBlast_PDB 72.0730% -77 - C1 -2PVU - ? -
48 HHSearch 71.9926% -76 - C1 -2PVU - ? -
7 PsiBlast_PDB 71.7730% -75 - C1 -2Q2A - ? -
53 HHSearch 71.5922% -58 - C1 -1LST - ARGT_SALTY -
2 PsiBlast_PDB 71.0432% -57 - C1 -2YLN - ? -
54 HHSearch 70.9921% -81 - C1 -3H7M - ? -
57 HHSearch 70.7120% -73 - C1 -2Y7I - ? -
11 PsiBlast_PDB 69.6725% -51 - C1 -1HSL - HISJ_ECOLI -
3 PsiBlast_PDB 69.4432% -63 - C1 -3ZSF - ? -
59 HHSearch 69.1720% -65 - C1 -3KBR - PHEC_PSEAE -
8 PsiBlast_PDB 68.8225% -74 - C1 -2O1M - TCYK_BACSU -
62 HHSearch 68.7921% -86 - C1 -1II5 - ? -