@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1706: (2015-12-10 )
MALELLTPFTKVELEEKKRDTNRKQIGIMGGNFNPVHNAHLVVADQVRQQLCLDQVLLMPEFQPPHIDKKETIDEQHRLKMLELAIEGIDGLSIEPIEIERKGISYTYDTMKLLIEKNPDVDYYFIIGADMVEYLPKWHRIDELVKMVQFVGVQRPKYKAGTSYPVIWVDLPLMDISSSMIRQFIKSNRQPNYLLPKEVLDYIRKEGLYK

Atome Classification :

(43 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DND_D_11(3E27)
?
[Raw transfer]




NXX_A_8(2QTR)
NADD_BACAC
[Raw transfer]




DND_H_8(1KAQ)
NADD_BACSU
[Raw transfer]




DND_C_9(3E27)
?
[Raw transfer]




NXX_A_8(2QTR)
NADD_BACAC
[Raw transfer]




NXX_B_9(2QTR)
NADD_BACAC
[Raw transfer]




NXX_C_10(2QTR)
NADD_BACAC
[Raw transfer]




DND_B_7(3E27)
?
[Raw transfer]




DND_L_12(1KAQ)
NADD_BACSU
[Raw transfer]




DND_A_5(3E27)
?
[Raw transfer]




DND_I_9(1KAQ)
NADD_BACSU
[Raw transfer]




DND_D_4(2H29)
NADD_STAAC
[Raw transfer]




DND_K_11(1KAQ)
NADD_BACSU
[Raw transfer]




DND_D_4(2H29)
NADD_STAAC
[Raw transfer]




DND_C_3(2H29)
NADD_STAAC
[Raw transfer]




DND_J_10(1KAQ)
NADD_BACSU
[Raw transfer]




DND_G_7(1KAQ)
NADD_BACSU
[Raw transfer]




GOL_B_8(2QTM)
?
[Raw transfer]




FMT_A_7(3MLA)
NADD_BACAC
[Raw transfer]




NCN_B_5(2QTN)
?
[Raw transfer]




LJZ_A_5(3MLB)
NADD_BACAC
[Raw transfer]




LJZ_A_5(3MLB)
NADD_BACAC
[Raw transfer]




FMT_B_10(3MLA)
NADD_BACAC
[Raw transfer]




GOL_A_9(2QTN)
?
[Raw transfer]




GOL_A_6(2QTM)
?
[Raw transfer]




JJZ_A_3(3MLA)
NADD_BACAC
[Raw transfer]




NCN_A_6(1YUM)
NADD_PSEAE
[Raw transfer]




NCN_A_6(1YUM)
NADD_PSEAE
[Raw transfer]




DZ9_A_3(3HFJ)
?
[Raw transfer]




CIT_E_5(1K4M)
NADD_ECOLI
[Raw transfer]




CIT_E_5(1K4M)
NADD_ECOLI
[Raw transfer]




JJZ_A_3(3MLA)
NADD_BACAC
[Raw transfer]




DZ9_A_3(3HFJ)
?
[Raw transfer]




CIT_A_2(1YUL)
NADD_PSEAE
[Raw transfer]




42 PsiBlast_CBE 93.6547%-157 - C4 -3MLA 5.5 NADD_BACAC
41 PsiBlast_CBE 92.9047%-153 - C4 -3MLB 6.6 NADD_BACAC
8 PsiBlast_PDB 92.8447%-155 - C4 -3MLA 5.9 NADD_BACAC
34 PsiBlast_CBE 92.6947%-166 - C4 -3MMX - NADD_BACAC -
10 PsiBlast_PDB 92.3547%-164 - C4 -3MMX - NADD_BACAC -
39 PsiBlast_CBE 92.1347%-162 - C4 -3MMX - NADD_BACAC -
35 PsiBlast_CBE 91.9947%-165 - C4 -3MMX - NADD_BACAC -
9 PsiBlast_PDB 91.5947%-154 - C4 -3MLB 6.5 NADD_BACAC
3 PsiBlast_PDB 91.5647%-158 - C4 -3DV2 - ? -
43 PsiBlast_CBE 91.5147%-151 * C4 *3HFJ 5.4 ?
27 PsiBlast_CBE 91.4247%-158 - C4 -3DV2 - ? -
36 PsiBlast_CBE 91.3247%-165 - C4 -3MMX - NADD_BACAC -
7 PsiBlast_PDB 91.2647%-151 - C4 -3HFJ 5.1 ?
40 PsiBlast_CBE 91.1647%-157 - C4 -3MMX - NADD_BACAC -
33 PsiBlast_CBE 91.0847%-148 - C4 -2QTM 2.8 ?
38 PsiBlast_CBE 90.9147%-157 - C4 -3MMX - NADD_BACAC -
28 PsiBlast_CBE 90.8647%-151 - C4 -3DV2 - ? -
4 PsiBlast_PDB 90.7747%-152 - C4 -2QTM 2.7 ?
26 PsiBlast_CBE 90.5947%-151 - C4 -3DV2 - ? -
37 PsiBlast_CBE 90.5347%-158 - C4 -3MMX - NADD_BACAC -
80 HHSearch 89.8947%-143 - C4 -2QTR 11.1 NADD_BACAC
32 PsiBlast_CBE 89.7647%-142 - C4 -2QTN 4.7 ?
5 PsiBlast_PDB 89.5747%-147 - C4 -2QTN 2.6 ?
11 PsiBlast_PDB 89.4547%-143 - C4 -2QTR 11.0 NADD_BACAC
45 PsiBlast_CBE 88.8147%-144 - C4 -2QTR 10.5 NADD_BACAC
22 PsiBlast_CBE 88.3044%-148 - C4 -1KAQ 8.2 NADD_BACSU
44 PsiBlast_CBE 88.1547%-144 - C4 -2QTR 10.9 NADD_BACAC
24 PsiBlast_CBE 88.1144%-145 - C4 -1KAQ 9.2 NADD_BACSU
2 PsiBlast_PDB 88.0944%-141 - C4 -1KAQ 10.5 NADD_BACSU
6 PsiBlast_PDB 87.7147%-143 - C4 -3E27 8.3 ?
23 PsiBlast_CBE 87.6244%-140 - C4 -1KAQ 9.6 NADD_BACSU
30 PsiBlast_CBE 87.5547%-140 - C4 -3E27 10.7 ?
21 PsiBlast_CBE 87.2844%-156 - C4 -1KAQ 7.4 NADD_BACSU
25 PsiBlast_CBE 86.9444%-141 - C4 -1KAQ 10.1 NADD_BACSU
29 PsiBlast_CBE 86.5047%-141 - C4 -3E27 8.2 ?
31 PsiBlast_CBE 86.2647%-143 - C4 -3E27 8.0 ?
46 PsiBlast_CBE 84.9941%-133 - C4 -2H29 10.1 NADD_STAAC
12 PsiBlast_PDB 84.8541%-134 - C4 -2H29 10.0 NADD_STAAC
83 HHSearch 84.3441%-133 - C4 -2H29 10.0 NADD_STAAC
81 HHSearch 81.8532%-132 - C4 -1YUM 3.8 NADD_PSEAE
17 PsiBlast_PDB 77.4430%-127 - C4 -1YUL 3.5 NADD_PSEAE
79 HHSearch 76.3630%-126 - C4 -1K4M 4.0 NADD_ECOLI
15 PsiBlast_PDB 76.1530%-127 - C4 -1YUM 3.8 NADD_PSEAE