@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1760: (2015-12-10 )
MWPEDRIASFRRTLLGWYDQEKRDLPWRRTTNPYYIWVSEIMLQQTQVNTVIPYYKRFLEWFPQIKDLADAPEEQLLKAWEGLGYYSRVRNMQKAAQQVMVDFGGIFPHTYDDIASLKGIGPYTAGAIASISFNLPEPAVDGNVMRVMARLFEVNYDIGDPKNRKIFQAIMEILIDPDRPGDFNQALMDLGTDIESAKTPRPDESPIRFFNAAYLNGTYSKYPIKNPKKKPKPMRIQAFVIRNQNGQYLLEKNTKGRLLGGFWSFPIIETSPLSQQLDLFDDNQSNPIIWQTQNETFQREYQLKPQWTDNHFPNIKHTFSHQKWTIELIEGVVKATDLPNAPHLKWAAIEDFSLYPFATPQKKMLETYLKQKNA

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADE_A_3(1MUD)
MUTY_ECOLI
[Raw transfer]




ADE_A_2(1WEI)
MUTY_ECOLI
[Raw transfer]




GOL_A_6(1KQJ)
MUTY_ECOLI
[Raw transfer]




GOL_A_9(1KG6)
MUTY_ECOLI
[Raw transfer]




GOL_A_4(1KG5)
MUTY_ECOLI
[Raw transfer]




GOL_A_7(1KG5)
MUTY_ECOLI
[Raw transfer]




IMD_A_4(1WEG)
MUTY_ECOLI
[Raw transfer]




NACID_C_3(3G0Q)
?
[Raw transfer]

-

IMD_A_4(1MUY)
MUTY_ECOLI
[Raw transfer]




IMD_A_7(1MUN)
MUTY_ECOLI
[Raw transfer]




NACID_C_3(4YOQ)
?
[Raw transfer]

-

NACID_C_3(3FSP)
?
[Raw transfer]

-

NACID_E_5(4YPR)
?
[Raw transfer]

-

NACID_B_1(1RRS)
?
[Raw transfer]

-

NACID_B_2(3FSP)
?
[Raw transfer]

-

NACID_C_3(4YPR)
?
[Raw transfer]

-

NACID_B_1(1RRQ)
?
[Raw transfer]

-

EDO_A_3(1WEG)
MUTY_ECOLI
[Raw transfer]




NACID_B_1(1RRQ)
?
[Raw transfer]

-

NACID_B_1(1VRL)
?
[Raw transfer]

-

NACID_B_2(4YPH)
?
[Raw transfer]

-

4 PsiBlast_PDB 93.9837% -85 - C2 -3G0Q 10.0 ?
25 HHSearch 93.2337% -82 * C2 *3FSP 11.7 ?
6 PsiBlast_PDB 93.1037% -87 - C2 -4YPH 10.8 ?
7 PsiBlast_PDB 92.3137% -84 - C2 -1RRQ 11.3 ?
3 PsiBlast_PDB 91.8337% -82 - C2 -1VRL 11.0 ?
48 Fugue 91.7536% -76 - C2 -1RRQ 11.6 ?
5 PsiBlast_PDB 91.5937% -84 - C2 -4YOQ 9.6 ?
21 PsiBlast_CBE 91.4737% -80 - C2 -4YPR 12.3 ?
8 PsiBlast_PDB 91.4237% -79 - C2 -4YPR 11.0 ?
2 PsiBlast_PDB 91.1637% -82 - C2 -1RRS 10.5 ?
1 PsiBlast_PDB 90.8237% -80 - C2 -3FSP 11.3 ?
16 PsiBlast_PDB 79.2943% -89 - C2 -1WEF - MUTY_ECOLI -
15 PsiBlast_PDB 78.0843% -91 - C2 -1KG3 - MUTY_ECOLI -
27 HHSearch 77.2343% -87 - C2 -1KG2 - MUTY_ECOLI -
24 PsiBlast_CBE 77.2342% -88 - C2 -1MUD 3.4 MUTY_ECOLI
13 PsiBlast_PDB 77.1743% -88 - C2 -1MUY 3.6 MUTY_ECOLI
19 PsiBlast_PDB 77.0543% -85 - C2 -1KQJ 3.0 MUTY_ECOLI
11 PsiBlast_PDB 76.9643% -88 - C2 -1KG5 2.3 MUTY_ECOLI
20 PsiBlast_PDB 76.7543% -88 - C2 -1KG7 - MUTY_ECOLI -
9 PsiBlast_PDB 76.6343% -87 - C2 -1KG4 - MUTY_ECOLI -
18 PsiBlast_PDB 76.5643% -85 - C2 -1KG6 2.0 MUTY_ECOLI
10 PsiBlast_PDB 75.9443% -86 - C2 -1WEG 4.0 MUTY_ECOLI
23 PsiBlast_CBE 75.7942% -87 - C2 -1MUN 4.1 MUTY_ECOLI
17 PsiBlast_PDB 74.7143% -81 - C2 -1WEI 2.9 MUTY_ECOLI