@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1762: (2015-12-10 )
MALEVTDATFVEETKEGLVLIDFWATWCGPCRMQAPILEQLSQEIDEDELKILKMDVDENPETARQFGIMSIPTLMFKKDGEVVKQVAGVHTKDQLKAIIAELS

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

MPD_A_9(2TRX)
THIO_ECOLI
[Raw transfer]




29 PsiBlast_CBE 86.4549%-106 - C1 -3O6T - THIO_MYCTU -
23 PsiBlast_CBE 85.7851%-102 - C1 -1NW2 - THIO_ALIAC -
18 PsiBlast_PDB 85.7549%-110 - C1 -3O6T - THIO_MYCTU -
129 HHSearch 85.6251%-105 * C1 *2YJ7 - ? -
12 PsiBlast_PDB 85.3750%-109 - C1 -2I1U - THIO_MYCTU -
31 PsiBlast_CBE 85.2849%-101 - C1 -3O6T - THIO_MYCTU -
30 PsiBlast_CBE 85.2449% -99 - C1 -3O6T - THIO_MYCTU -
127 HHSearch 84.5651%-103 - C1 -1NSW - THIO_ALIAC -
24 PsiBlast_CBE 84.4451% -97 - C1 -1NW2 - THIO_ALIAC -
7 PsiBlast_PDB 84.2351% -92 - C1 -1NW2 - THIO_ALIAC -
135 HHSearch 84.1453%-109 - C1 -2VOC - THIO_BACSU -
22 PsiBlast_CBE 84.0851%-100 - C1 -1NW2 - THIO_ALIAC -
21 PsiBlast_CBE 83.9751%-101 - C1 -1NW2 - THIO_ALIAC -
32 PsiBlast_CBE 83.9449%-104 - C1 -3NOF - ? -
11 PsiBlast_PDB 83.7250%-109 - C1 -2L59 - THIO_MYCTU -
6 PsiBlast_PDB 83.2751% -95 - C1 -1NSW - THIO_ALIAC -
17 PsiBlast_PDB 83.2649%-102 - C1 -3NOF - ? -
38 PsiBlast_CBE 83.2352%-105 - C1 -2YJ7 - ? -
2 PsiBlast_PDB 83.1556%-105 - C1 -2GZZ - THIO_BACSU -
27 PsiBlast_CBE 83.1151%-101 - C1 -1NW2 - THIO_ALIAC -
114 Fugue 75.7939%-129 - C1 -2TRX 4.1 THIO_ECOLI