@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1890: (2015-12-11 )
MIKIIIVAHGNFPDGILSSLELIAGHQEYVVGINFIAGMSSNDVRVALQREVIDFKEILVLTDLLGGTPFNVSSALSVEYTDKKIKVLSGLNLSMLMEAVLSRTMFEHVDDLVDKVITSSHEGIVDFSTCLATQTAEATFEGGI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_E_16(4TKZ)
?
[Raw transfer]




GOL_C_11(4TKZ)
?
[Raw transfer]




GOL_D_12(4TKZ)
?
[Raw transfer]




GOL_B_9(4TKZ)
?
[Raw transfer]




GOL_A_8(4TKZ)
?
[Raw transfer]




15 PsiBlast_CBE 95.43100%-156 - C2 -4TKZ 3.0 ?
13 PsiBlast_CBE 95.38100%-157 - C2 -4TKZ - ? -
14 PsiBlast_CBE 95.25100%-158 - C2 -4TKZ 2.3 ?
17 PsiBlast_CBE 94.84100%-154 - C2 -4TKZ 2.1 ?
16 PsiBlast_CBE 94.62100%-153 - C2 -4TKZ 3.1 ?
1 PsiBlast_PDB 94.17100%-152 - C2 -4TKZ 3.0 ?
21 HHSearch 68.8929%-150 - C2 -3LFH - ? -
9 PsiBlast_PDB 68.7323%-135 - C2 -3IPR - ? -
7 PsiBlast_PDB 65.9330%-132 - C2 -1VSQ - PTNAB_ECOLI -
4 PsiBlast_PDB 65.9330%-132 - C2 -2JZO - PTNAB_ECOLI -
20 HHSearch 65.6229%-126 - C2 -1PDO - PTNAB_ECOLI -
18 HHSearch 65.4823%-127 - C2 -3IPR - ? -
6 PsiBlast_PDB 65.2430%-133 - C2 -2JZN - -
3 PsiBlast_PDB 64.5630%-131 - C2 -1PDO - PTNAB_ECOLI -
5 PsiBlast_PDB 64.3230%-131 - C2 -1VRC - PTNAB_ECOLI -
24 HHSearch 59.9719%-143 - C2 -3GDW - ? -
22 HHSearch 58.7625%-127 - C2 -3MTQ - ? -
2 PsiBlast_PDB 58.4234%-184 - C2 -3LFH - ? -
10 PsiBlast_PDB 56.0326%-119 - C2 -3MTQ - ? -
23 HHSearch 54.5913%-136 - C2 -3GX1 - ? -