@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1903: (2015-12-11 )
MFIFKRKKQVEMPLEKIPAHIGIIMDGNGRWAKKRLKPRVMGHKAGMDALQEVTIAASGLGVKVLTVYAFSTENWSRPDDEVKFIMNLPVEFFDKYVPELDKNNVRVQVIGDTHKLPKATYDAMQRACLRTKHNSGLVLNFALNYGGRSEITNAIKEIAQDVLEAKLNPDDITEDLVANHLMTNSLPYLYRDPDLIIRTSGELRLSNFLPWQSAYSEFYFTPVLWPDFKKDELHKAIVDYNQRHRRFGSV

Atome Classification :

(50 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GPP_D_19(2VG3)
DPDS_MYCTU
[Raw transfer]




FPP_B_15(4Q9M)
ISPT_STRR6
[Raw transfer]




GPP_A_6(2VG3)
DPDS_MYCTU
[Raw transfer]




FPP_A_3(4H8E)
ISPT_STAAN
[Raw transfer]




FPS_C_3(1X08)
UPPS_ECOLI
[Raw transfer]




GPP_A_6(2VG3)
DPDS_MYCTU
[Raw transfer]




IPE_A_4(1X07)
UPPS_ECOLI
[Raw transfer]




FPP_A_4(4Q9M)
ISPT_STRR6
[Raw transfer]




GPP_B_9(2VG3)
DPDS_MYCTU
[Raw transfer]




H78_A_3(3WYJ)
UPPS_ECOLI
[Raw transfer]




IPE_A_3(1X09)
UPPS_ECOLI
[Raw transfer]




DPO_C_20(2VG2)
DPDS_MYCTU
[Raw transfer]




FPS_A_4(1X06)
UPPS_ECOLI
[Raw transfer]




40B_B_4(4ONC)
DPDS_MYCTU
[Raw transfer]




FPS_A_3(4U82)
ISPT_STAAN
[Raw transfer]




B75_B_5(2E9C)
UPPS_ECOLI
[Raw transfer]




GPP_C_15(2VG3)
DPDS_MYCTU
[Raw transfer]




FPP_C_3(1V7U)
UPPS_ECOLI
[Raw transfer]




DPO_C_3(2DTN)
ISPT_HELPY
[Raw transfer]




2BJ_B_4(3SGV)
UPPS_ECOLI
[Raw transfer]




2BJ_B_4(3SGV)
UPPS_ECOLI
[Raw transfer]




B28_B_5(2E9A)
UPPS_ECOLI
[Raw transfer]




GPP_A_3(2VG0)
ZFPP_MYCTU
[Raw transfer]




2BJ_A_5(3SGV)
UPPS_ECOLI
[Raw transfer]




B76_A_3(2E9D)
UPPS_ECOLI
[Raw transfer]




TH9_B_3(3TH8)
UPPS_ECOLI
[Raw transfer]




B08_A_5(2E99)
UPPS_ECOLI
[Raw transfer]




GOL_B_19(2VG2)
DPDS_MYCTU
[Raw transfer]




40B_A_3(4ONC)
DPDS_MYCTU
[Raw transfer]




B29_A_4(2E98)
UPPS_ECOLI
[Raw transfer]




0FW_A_4(3SGX)
UPPS_ECOLI
[Raw transfer]




FFT_B_3(3UGS)
ISPT_CAMJE
[Raw transfer]




IPE_A_4(1X09)
UPPS_ECOLI
[Raw transfer]




FFT_A_4(3UGS)
ISPT_CAMJE
[Raw transfer]




IPE_B_15(2VG2)
DPDS_MYCTU
[Raw transfer]




FPP_B_11(2VG1)
ZFPP_MYCTU
[Raw transfer]




B28_A_4(2E9A)
UPPS_ECOLI
[Raw transfer]




B29_A_5(2E98)
UPPS_ECOLI
[Raw transfer]




B08_B_7(2E99)
UPPS_ECOLI
[Raw transfer]




SAX_B_3(3SH0)
UPPS_ECOLI
[Raw transfer]




FFT_B_3(3UGS)
ISPT_CAMJE
[Raw transfer]




P09_B_3(3SGT)
UPPS_ECOL6
[Raw transfer]




B29_B_8(2E98)
UPPS_ECOLI
[Raw transfer]




2BJ_A_7(3SGV)
UPPS_ECOLI
[Raw transfer]




2ZW_B_5(4Q9O)
ISPT_STRR6
[Raw transfer]




2ZW_B_14(4Q9M)
ISPT_STRR6
[Raw transfer]




2ZW_A_3(4Q9O)
ISPT_STRR6
[Raw transfer]




0YZ_A_4(4H3C)
UPPS_ECOLI
[Raw transfer]




53Q_A_3(5CQJ)
?
[Raw transfer]




B75_A_6(2E9C)
UPPS_ECOLI
[Raw transfer]




OXN_B_11(1UEH)
UPPS_ECOLI
[Raw transfer]




PGE_A_3(5CQB)
?
[Raw transfer]




22 PsiBlast_CBE 96.1770% -99 - C8 -4Q9M 9.2 ISPT_STRR6
2 PsiBlast_PDB 96.1670% -94 - C8 -4Q9O 8.7 ISPT_STRR6
21 PsiBlast_CBE 96.1570% -97 - C8 -4Q9O 8.8 ISPT_STRR6
1 PsiBlast_PDB 94.6070% -96 - C8 -4Q9M 9.2 ISPT_STRR6
4 PsiBlast_PDB 92.0054% -92 - C8 -4U82 10.3 ISPT_STAAN
3 PsiBlast_PDB 91.2354% -94 - C8 -4H8E 10.6 ISPT_STAAN
5 PsiBlast_PDB 91.2054% -86 - C8 -3WYI - ? -
56 PsiBlast_CBE 89.4842% -97 - C8 -2VG2 2.6 DPDS_MYCTU
81 HHSearch 88.7542% -86 - C8 -2VG3 7.6 DPDS_MYCTU
50 PsiBlast_CBE 88.4642% -93 - C8 -4ONC 4.4 DPDS_MYCTU
51 PsiBlast_CBE 88.3242% -94 - C8 -4ONC 7.3 DPDS_MYCTU
57 PsiBlast_CBE 88.2842% -96 - C8 -2VG2 3.8 DPDS_MYCTU
54 PsiBlast_CBE 88.0342% -89 - C8 -2VG3 7.9 DPDS_MYCTU
52 PsiBlast_CBE 87.9842% -97 - C8 -2VG3 7.3 DPDS_MYCTU
59 PsiBlast_CBE 87.8742%-109 - C- -2VG2 - DPDS_MYCTU -
58 PsiBlast_CBE 87.8042% -93 - C8 -2VG2 4.2 DPDS_MYCTU
53 PsiBlast_CBE 87.8042% -94 - C8 -2VG3 7.0 DPDS_MYCTU
55 PsiBlast_CBE 87.7242% -89 - C8 -2VG3 7.6 DPDS_MYCTU
8 PsiBlast_PDB 87.2844% -99 - C8 -1V7U 6.7 UPPS_ECOLI
10 PsiBlast_PDB 86.9744% -96 - C8 -1X07 5.9 UPPS_ECOLI
49 PsiBlast_CBE 86.9644% -96 - C8 -1X08 7.3 UPPS_ECOLI
48 PsiBlast_CBE 86.8644% -94 - C8 -1X09 5.0 UPPS_ECOLI
9 PsiBlast_PDB 86.7444% -94 - C8 -1X06 8.8 UPPS_ECOLI
18 PsiBlast_PDB 86.7144%-103 - C8 -3SGT 5.7 UPPS_ECOL6
37 PsiBlast_CBE 85.9044%-104 - C8 -3SH0 4.2 UPPS_ECOLI
19 PsiBlast_PDB 85.6944%-103 - C8 -3SGV 6.5 UPPS_ECOLI
46 PsiBlast_CBE 85.4344% -98 - C8 -1UEH 3.8 UPPS_ECOLI
47 PsiBlast_CBE 85.2844%-101 - C8 -5CQB 1.6 ?
42 PsiBlast_CBE 85.2644%-104 - C8 -2E9A 3.9 UPPS_ECOLI
24 PsiBlast_CBE 85.2544%-105 - C8 -5CQJ 3.0 ?
36 PsiBlast_CBE 85.0644%-100 - C8 -3TH8 6.0 UPPS_ECOLI
39 PsiBlast_CBE 84.8644%-100 - C8 -3SGV 5.1 UPPS_ECOLI
12 PsiBlast_PDB 84.8444% -95 - C8 -2E99 5.5 UPPS_ECOLI
79 HHSearch 84.7143% -92 * C8 *3SGV 6.5 UPPS_ECOLI
13 PsiBlast_PDB 84.3244%-101 - C8 -2E9A 6.1 UPPS_ECOLI
44 PsiBlast_CBE 84.0644%-105 - C8 -2E98 3.8 UPPS_ECOLI
35 PsiBlast_CBE 83.8344%-104 - C8 -3WYJ 8.7 UPPS_ECOLI
11 PsiBlast_PDB 83.7044% -98 - C8 -2E98 6.3 UPPS_ECOLI
43 PsiBlast_CBE 83.5544%-104 - C8 -2E99 5.0 UPPS_ECOLI
41 PsiBlast_CBE 83.4344%-100 - C8 -2E9C 5.8 UPPS_ECOLI
14 PsiBlast_PDB 83.4244%-100 - C8 -2E9C 2.7 UPPS_ECOLI
26 PsiBlast_CBE 83.2344%-103 - C8 -4H3C 3.7 UPPS_ECOLI
15 PsiBlast_PDB 82.5544%-102 - C8 -2E9D 5.0 UPPS_ECOLI
20 PsiBlast_PDB 82.2044%-105 - C8 -3SGX 6.7 UPPS_ECOLI
60 PsiBlast_CBE 77.9240% -84 - C8 -2DTN 4.7 ISPT_HELPY
67 PsiBlast_CBE 77.6333%-100 - C8 -2VG1 6.6 ZFPP_MYCTU
64 PsiBlast_CBE 77.3933% -96 - C8 -2VG0 6.4 ZFPP_MYCTU
62 PsiBlast_CBE 76.4835% -96 - C8 -3UGS 5.7 ISPT_CAMJE
61 PsiBlast_CBE 76.3835% -96 - C8 -3UGS 6.0 ISPT_CAMJE
82 HHSearch 76.1634% -89 - C8 -3UGS 6.0 ISPT_CAMJE