@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1944: (2015-12-12 )
MNIFILEDDFVQQAHFEKIIKEIRVQYNLHFKTVETFAKPVQLLESIYEIGLHNLFFLDIEIKNDEQMGLEVAKQIRQVDPYAQIVFVTTHSELMPLTFRYQVSALDYIDKGLSQEEFSQRIEEVLLYVDGICNKPLVENSFYFKSRYSQVQLPFNDLLYIETSSRSHRVVLYTEKDRMEFTATLGDILKQEPRLFQCHRSFLVNPLNIFKVDRIDRLVYFQNGTTCLVSRNKVRDIVSIVDKYQKDRKR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMT_A_6(3D6W)
?
[Raw transfer]




GOL_A_3(4G4K)
AGRA_STAAU
[Raw transfer]




NACID_C_2(3BS1)

[Raw transfer]

-

1 PsiBlast_PDB 94.4835%-143 - C2 -4CBV - ? -
3 PsiBlast_PDB 69.1040%-144 - C2 -4ML3 - ? -
2 PsiBlast_PDB 68.5840%-137 - C2 -4MLD - ? -
20 PsiBlast_PDB 57.7223%-109 - C2 -1QKK - DCTD_RHIME -
55 Fugue 53.6530%-110 - C2 -3BS1 - -
42 HHSearch 52.0320%-124 - C2 -1SRR - SP0F_BACSU -
39 HHSearch 51.8316%-119 - C2 -3CU5 - ? -
41 HHSearch 51.3617%-124 - C2 -2PL1 - PHOP_ECOLI -
56 Fugue 51.059%-115 - C2 -2B4A - ? -
35 HHSearch 50.9024%-116 - C2 -3B2N - ? -
45 HHSearch 49.7919%-123 - C2 -3W9S - ? -
4 PsiBlast_PDB 49.6233%-117 - C2 -3BS1 5.0
33 HHSearch 49.5316%-129 - C2 -1KGS - ? -
5 PsiBlast_PDB 49.3333%-118 - C2 -4G4K 3.0 AGRA_STAAU
38 HHSearch 48.5613%-104 - C2 -2AYX - RCSC_ECOLI -
43 HHSearch 48.4321%-106 - C2 -3N0R - ? -
15 PsiBlast_PDB 47.7328%-113 - C2 -3A10 - ? -
51 HHSearch 47.6710%-136 - C2 -1DCF - -
21 PsiBlast_CBE 46.8133%-116 - C2 -4G4K - -
12 PsiBlast_PDB 46.5525%-118 - C2 -1YIO - ? -