@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs2081: (2015-12-13 )
MKILVVEDEFDLNRSIVKLLKKQHYSVDSASNGEEALQFVSVAEYDVIILDVMMPKMDGFTFLKLLRNKGSQVSILMLTARDAVEDRIAGLDFGADDYLVKPFEFGELMARIRAMLRRANRQVSSDDIQIQDITINLSTKQVWRNDNLIDLTAKEYEVLEYLARHRDQVLSRHQIREHVWDYDYYGESNIIDVLIKNLRRKLDNNRDGSLIKTKRGLGYVIPK

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PHS_C_3(1NXP)
?
[Raw transfer]




ACY_C_3(1NXW)
?
[Raw transfer]




116 HHSearch 90.5342%-134 - C4 -1KGS - ? -
1 PsiBlast_PDB 89.8141%-134 - C4 -1KGS - ? -
113 HHSearch 86.2739%-130 - C5 -1YS7 - PRRA_MYCTU -
2 PsiBlast_PDB 83.8239%-127 - C5 -1YS6 - PRRA_MYCTU -
3 PsiBlast_PDB 82.3339%-132 - C5 -1YS7 - PRRA_MYCTU -
23 PsiBlast_CBE 82.0934%-135 - C4 -4KNY - KDPE_ECOLI -
22 PsiBlast_CBE 81.6339%-119 - C5 -1YS6 - PRRA_MYCTU -
6 PsiBlast_PDB 80.6034%-130 - C4 -4KFC - KDPE_ECOLI -
21 PsiBlast_CBE 79.7739%-116 - C5 -1YS7 - PRRA_MYCTU -
114 HHSearch 79.2535%-124 - C5 -2GWR - MTRA_MYCTU -
5 PsiBlast_PDB 78.3634%-132 - C4 -4KNY - KDPE_ECOLI -
20 PsiBlast_PDB 70.0428%-119 - C4 -2HQR - ? -
112 HHSearch 69.6329%-115 - C4 -2HQR - ? -
117 HHSearch 68.4238% -98 - C5 -2OQR - REGX3_MYCTU -
4 PsiBlast_PDB 67.0437% -95 - C5 -2OQR - REGX3_MYCTU -
24 PsiBlast_CBE 65.1847%-147 - C4 -3NNN - ? -
16 PsiBlast_PDB 63.1546%-158 - C4 -1NXX - ? -
14 PsiBlast_PDB 62.9446%-146 - C4 -1NXV - ? -
15 PsiBlast_PDB 62.7046%-146 - C4 -1NXW 3.9 ?
8 PsiBlast_PDB 61.8547%-146 - C4 -3NNN - ? -
12 PsiBlast_PDB 59.7346%-144 - C4 -1NXP 3.0 ?