@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00100: (2016-06-01 )
MNIKKCKQLLMSLVVLTLAVTCLAPMSKAKAASDPIDINASAAIMIEASSGKILYSKNADKRLPIASMTKMMTEYLLLEAIDQGKVKWDQTYTPDDYVYEISQDNSLSNVPLRKDGKYTVKELYQATAIYSANAAAIAIAEIVAGSETKFVEKMNAKAKELGLTDYKFVNATGLENKDLHGHQPEGTSVNEESEVSAKDMAVLADHLITDYPEILETSSIAKTKFREGTDDEMDMPNWNFMLKGLVSEYKKATVDGLKTGSTDSAGSCFTGTAERNGMRVITVVLNAKGNLHTGRFDETKKMFDYAFDNFSMKEIYAEGDQVKGHKTISVDKGKEKEVGIVTNKAFSLPVKNGEEKNYKAKVTLNKDNLTAPVKKGTKVGKLTAEYTGDEKDYGFLNSDLAGVDLVTKENVEKANWFVLTMRSIGGFFAGIWGSIVDTVTGWF

Atome Classification :

(29 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

UNL_H_8(1TVF)
?
[Raw transfer]




UNL_H_8(1TVF)
?
[Raw transfer]




UNL_I_9(1TVF)
?
[Raw transfer]




CEW_B_4(3HUM)
?
[Raw transfer]




SIN_B_5(4K91)
?
[Raw transfer]




HJ3_A_2(3BEB)
DACA_ECOLI
[Raw transfer]




HJ2_A_3(3BEC)
DACA_ECOLI
[Raw transfer]




SIN_A_3(4K91)
?
[Raw transfer]




CEW_A_3(3HUM)
?
[Raw transfer]




ZZ7_A_3(3HUN)
?
[Raw transfer]




ZZ7_A_3(3HUN)
?
[Raw transfer]




61 HHSearch 91.2138% -60 - C4 -1XP4 - ? -
58 HHSearch 87.5533% -65 - C4 -4K91 3.6 ?
59 HHSearch 85.3533% -59 - C4 -3ITA - DACC_ECOLI -
1 PsiBlast_PDB 85.2237% -50 - C4 -1XP4 - ? -
21 PsiBlast_CBE 81.4433% -64 - C4 -4K91 2.8 ?
3 PsiBlast_PDB 81.4132% -55 - C4 -3IT9 - DACC_ECOLI -
77 Fugue 80.9929% -71 - C4 -1HD8 - DACA_ECOLI -
28 PsiBlast_CBE 80.9132% -57 - C4 -3IT9 - DACC_ECOLI -
2 PsiBlast_PDB 80.0733% -63 - C4 -4K91 - ? -
4 PsiBlast_PDB 79.7232% -55 - C4 -3ITA - DACC_ECOLI -
25 PsiBlast_CBE 79.2332% -59 - C4 -3ITA - DACC_ECOLI -
22 PsiBlast_CBE 79.2232% -54 - C4 -3ITB - DACC_ECOLI -
57 HHSearch 79.1229% -63 - C4 -3MZF - DACA_ECOLI -
29 PsiBlast_CBE 78.4332% -56 - C4 -3IT9 - DACC_ECOLI -
24 PsiBlast_CBE 78.4332% -51 - C4 -3ITB - DACC_ECOLI -
23 PsiBlast_CBE 78.3932% -54 * C4 *3ITB - DACC_ECOLI -
26 PsiBlast_CBE 78.3332% -53 - C4 -3ITA - DACC_ECOLI -
5 PsiBlast_PDB 78.2532% -55 - C4 -3ITB - DACC_ECOLI -
60 HHSearch 78.1630% -59 - C4 -3A3J - DACA_HAEIN -
27 PsiBlast_CBE 77.9532% -53 - C4 -3IT9 - DACC_ECOLI -
13 PsiBlast_PDB 74.6731% -63 - C4 -3BEB 3.9 DACA_ECOLI
14 PsiBlast_PDB 72.4631% -63 - C4 -3BEC 3.6 DACA_ECOLI
64 HHSearch 69.9432% -58 - C4 -1TVF 2.7 ?
63 HHSearch 69.7830% -48 - C4 -3HUN 2.5 ?
9 PsiBlast_PDB 63.8533% -44 - C4 -1TVF 2.7 ?
8 PsiBlast_PDB 61.8233% -39 - C4 -3HUN 2.6 ?
32 PsiBlast_CBE 61.7233% -41 - C4 -1TVF 2.6 ?
31 PsiBlast_CBE 60.2633% -39 - C4 -3HUM 2.5 ?
7 PsiBlast_PDB 60.1433% -38 - C4 -3HUM 2.1 ?