@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00140: (2016-06-01 )
MKEHHIPKNSIITVAGTVGVGKSTLTKTLAKRLGFKTSLEEVDHNPYLEKFYHDFERWSFHLQIYFLAERFKEQKTIFEAGGGFVQDRSIYEDTGIFAKMHADKGTMSKVDYKTYTSLFEAMVMTPYFPHPDVLIYLEGDLENILNRIEQRGREMELQTSRSYWEEMHTRYENWISGFNACPVLKLRIEDYDLLNDENSIENIVDQIASVIHDNQKK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DCP_A_3(2JAQ)
?
[Raw transfer]




DCP_A_3(2JAQ)
?
[Raw transfer]




DTP_B_10(2JAS)
?
[Raw transfer]




DTP_C_12(2JAS)
?
[Raw transfer]




DTP_E_15(2JAS)
?
[Raw transfer]




DTP_F_17(2JAS)
?
[Raw transfer]




DTP_A_7(2JAS)
?
[Raw transfer]




DTP_D_13(2JAS)
?
[Raw transfer]




DCM_A_5(2JAT)
?
[Raw transfer]




DCM_B_8(2JAT)
?
[Raw transfer]




101 HHSearch 93.0327% -77 - C1 -2OCP - DGUOK_HUMAN -
102 HHSearch 92.9325% -84 - C1 -1P5Z - DCK_HUMAN -
103 HHSearch 90.8132% -88 * C1 *2JAQ 8.7 ?
4 PsiBlast_PDB 84.6023% -92 - C1 -2OCP - DGUOK_HUMAN -
2 PsiBlast_PDB 80.9334% -80 - C1 -2JAT 5.4 ?
21 PsiBlast_CBE 79.7334% -77 - C1 -2JAT 5.3 ?
26 PsiBlast_CBE 78.8034% -64 - C1 -2JAS 7.7 ?
1 PsiBlast_PDB 76.0534% -75 - C1 -2JAQ 8.7 ?
22 PsiBlast_CBE 76.0434% -65 - C1 -2JAS 7.2 ?
23 PsiBlast_CBE 75.2834% -67 - C1 -2JAS 8.9 ?
25 PsiBlast_CBE 74.9434% -64 - C1 -2JAS 8.3 ?
5 PsiBlast_PDB 73.3027% -67 - C1 -2A2Z - DCK_HUMAN -
107 HHSearch 72.9823% -55 - C1 -2VP4 - DNK_DROME -
10 PsiBlast_PDB 72.9425% -74 - C1 -1P60 - DCK_HUMAN -
24 PsiBlast_CBE 71.9534% -62 - C1 -2JAS 7.0 ?
3 PsiBlast_PDB 71.8734% -58 - C1 -2JAS 7.0 ?
92 Fugue 71.7022% -40 - C1 -1J90 - DNK_DROME -
6 PsiBlast_PDB 71.4427% -68 - C1 -2A30 - DCK_HUMAN -
7 PsiBlast_PDB 70.8625% -76 - C1 -3IPX - DCK_HUMAN -
11 PsiBlast_PDB 70.6825% -76 - C1 -1P61 - DCK_HUMAN -