@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00180: (2016-06-01 )
MTQDELYMKEAIKEAKKAEEKGEVPIGAVLVINGEIIARAHNLRETEQRSIAHAEMLVIDEACKALGTWRLEGATLYVTLEPCPMCAGAVVLSRVEKVVFGAFDPKGGCSGTLMNLLQEERFNHQAEVVSGVLEEECGGMLSAFFRELRKKKKAARKNLSE

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

IMD_A_5(1WKQ)
GUAD_BACSU
[Raw transfer]




IMD_B_6(1WKQ)
GUAD_BACSU
[Raw transfer]




CHAIN_H_4(2B3J)
TADA_STAAM
[Raw transfer]

-

GOL_A_10(2B3J)
TADA_STAAM
[Raw transfer]




GOL_B_12(2B3J)
TADA_STAAM
[Raw transfer]




CHAIN_G_3(2B3J)
TADA_STAAM
[Raw transfer]

-

CHAIN_F_2(2B3J)
TADA_STAAM
[Raw transfer]

-

CHAIN_E_1(2B3J)
TADA_STAAM
[Raw transfer]

-

CHAIN_E_1(2B3J)
TADA_STAAM
[Raw transfer]

-

23 PsiBlast_CBE 96.1261%-110 - C5 -2B3J 10.4 TADA_STAAM
75 HHSearch 94.6561%-108 - C5 -2B3J 8.9 TADA_STAAM
21 PsiBlast_CBE 94.6561%-105 - C5 -2B3J 8.0 TADA_STAAM
1 PsiBlast_PDB 94.6561%-108 - C5 -2B3J 8.9 TADA_STAAM
22 PsiBlast_CBE 94.6261%-111 - C5 -2B3J 9.0 TADA_STAAM
2 PsiBlast_PDB 87.8045%-104 - C5 -2NX8 - TADA_STRP6 -
73 HHSearch 87.4045%-102 - C5 -2NX8 - TADA_STRP6 -
27 PsiBlast_CBE 87.1644%-113 - C5 -1Z3A - TADA_ECOLI -
72 HHSearch 87.1343%-106 * C5 *1Z3A - TADA_ECOLI -
24 PsiBlast_CBE 87.1352%-114 - C5 -1WWR - TADA_AQUAE -
76 HHSearch 87.0651%-107 - C5 -1WWR - TADA_AQUAE -
25 PsiBlast_CBE 86.4252%-109 - C5 -1WWR - TADA_AQUAE -
26 PsiBlast_CBE 86.3652%-114 - C5 -1WWR - TADA_AQUAE -
4 PsiBlast_PDB 86.3344%-110 - C5 -1Z3A - TADA_ECOLI -
5 PsiBlast_PDB 86.1945%-108 - C5 -3OCQ - ? -
3 PsiBlast_PDB 86.1152%-111 - C5 -1WWR - TADA_AQUAE -
28 PsiBlast_CBE 82.2144%-104 - C5 -2A8N - TADA_AGRFC -
87 HHSearch 81.5240%-120 - C5 -2HXV - ? -
13 PsiBlast_PDB 79.6536%-112 - C5 -2HXV - ? -
94 Fugue 78.9331%-110 - C5 -2B3Z - RIBD_BACSU -
32 PsiBlast_CBE 69.4740%-123 - C5 -1WKQ 4.2 GUAD_BACSU
8 PsiBlast_PDB 68.8640%-119 - C5 -1WKQ 4.2 GUAD_BACSU