Study : bsu00280 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C2_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C2_S1
Complex: MRD_A_3(3V9P) / Model_57(3V9P/A) = [3.1] Download484.0817.75MSGLFITFEGPEGAGKTTVLQEIKNILTAEGLQVMATREPGGIDIAEQIREVILNENNILMDPKTEALLYAAARRQHLVEKVKPALEQGFIVLCDRFIDSSLAYQGYARGLGIDEVLSINEFAIGDMMPHVTVYFSIDPEEGLKRIYANGSREKNRLDLEKLDFHTKVQEGYQELMKRFPERFHSVDAGQSKDLVVQDVLKVIDEALKKIQL
Complex: MRD_B_7(3V9P) / Model_56(3V9P/B) = [3.1] Download528.2423.55MSGLFITFEGPEGAGKTTVLQEIKNILTAEGLQVMATREPGGIDIAEQIREVILNENNILMDPKTEALLYAAARRQHLVEKVKPALEQGFIVLCDRFIDSSLAYQGYARGLGIDEVLSINEFAIGDMMPHVTVYFSIDPEEGLKRIYANGSREKNRLDLEKLDFHTKVQEGYQELMKRFPERFHSVDAGQSKDLVVQDVLKVIDEALKKIQL
Complex: MRD_A_3(3V9P) / Model_125(3V9P/A) = [3.1] Download524.8717.75MSGLFITFEGPEGAGKTTVLQEIKNILTAEGLQVMATREPGGIDIAEQIREVILNENNILMDPKTEALLYAAARRQHLVEKVKPALEQGFIVLCDRFIDSSLAYQGYARGLGIDEVLSINEFAIGDMMPHVTVYFSIDPEEGLKRIYANGSREKNRLDLEKLDFHTKVQEGYQELMKRFPERFHSVDAGQSKDLVVQDVLKVIDEALKKIQL
Complex: 0DN_D_12(3UXM) / Model_46(3UXM/D) = [3.7] Download404.596.75MSGLFITFEGPEGAGKTTVLQEIKNILTAEGLQVMATREPGGIDIAEQIREVILNENNILMDPKTEALLYAAARRQHLVEKVKPALEQGFIVLCDRFIDSSLAYQGYARGLGIDEVLSINEFAIGDMMPHVTVYFSIDPEEGLKRIYANGSREKNRLDLEKLDFHTKVQEGYQELMKRFPERFHSVDAGQSKDLVVQDVLKVIDEALKKIQL
Complex: THM_A_2(4ESH) / Model_20(4ESH/A) = [3.8] Download443.879.90MSGLFITFEGPEGAGKTTVLQEIKNILTAEGLQVMATREPGGIDIAEQIREVILNENNILMDPKTEALLYAAARRQHLVEKVKPALEQGFIVLCDRFIDSSLAYQGYARGLGIDEVLSINEFAIGDMMPHVTVYFSIDPEEGLKRIYANGSREKNRLDLEKLDFHTKVQEGYQELMKRFPERFHSVDAGQSKDLVVQDVLKVIDEALKKIQL
Consensus
[pKd Mean = 3.36]
-477
(s=47)
15
(s=6)
MSGLFITFEGPEGAGKTTVLQEIKNILTAEGLQVMATREPGGIDIAEQIREVILNENNILMDPKTEALLYAAARRQHLVEKVKPALEQGFIVLCDRFIDSSLAYQGYARGLGIDEVLSINEFAIGDMMPHVTVYFSIDPEEGLKRIYANGSREKNRLDLEKLDFHTKVQEGYQELMKRFPERFHSVDAGQSKDLVVQDVLKVIDEALKKIQL