@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00280: (2016-06-01 )
MSGLFITFEGPEGAGKTTVLQEIKNILTAEGLQVMATREPGGIDIAEQIREVILNENNILMDPKTEALLYAAARRQHLVEKVKPALEQGFIVLCDRFIDSSLAYQGYARGLGIDEVLSINEFAIGDMMPHVTVYFSIDPEEGLKRIYANGSREKNRLDLEKLDFHTKVQEGYQELMKRFPERFHSVDAGQSKDLVVQDVLKVIDEALKKIQL

Atome Classification :

(67 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

32K_B_4(4QG7)
KTHY_STAAR
[Raw transfer]




16T_A_3(4HLD)
KTHY_STAAR
[Raw transfer]




Z5A_A_2(5TMP)
KTHY_ECOLI
[Raw transfer]




16T_B_4(4HLD)
KTHY_STAAR
[Raw transfer]




T5A_A_2(4TMK)
KTHY_ECOLI
[Raw transfer]




32B_A_3(4QGF)
KTHY_STAAR
[Raw transfer]




13Y_B_4(4HDC)
KTHY_STAAN
[Raw transfer]




32K_A_3(4QG7)
KTHY_STAAR
[Raw transfer]




T5A_A_2(4TMK)
KTHY_ECOLI
[Raw transfer]




T5A_A_2(4TMK)
KTHY_ECOLI
[Raw transfer]




13Y_A_3(4HDC)
KTHY_STAAN
[Raw transfer]




32C_B_4(4QGG)
KTHY_STAAR
[Raw transfer]




43N_B_4(4XWA)
KTHY_STAA1
[Raw transfer]




43N_A_3(4XWA)
KTHY_STAA1
[Raw transfer]




32E_B_4(4QGH)
KTHY_STAAR
[Raw transfer]




31Z_B_4(4QGA)
KTHY_STAAR
[Raw transfer]




31Z_A_3(4QGA)
KTHY_STAAR
[Raw transfer]




32C_A_3(4QGG)
KTHY_STAAR
[Raw transfer]




TYD_B_7(3HJN)
KTHY_THEMA
[Raw transfer]




T05_A_3(4HLC)
KTHY_STAAR
[Raw transfer]




T05_A_3(4HLC)
KTHY_STAAR
[Raw transfer]




32E_A_3(4QGH)
KTHY_STAAR
[Raw transfer]




T05_B_4(4HLC)
KTHY_STAAR
[Raw transfer]




ATM_D_15(4GMD)
KTHY_PSEAE
[Raw transfer]




ATM_A_5(4GMD)
KTHY_PSEAE
[Raw transfer]




TYD_A_4(3HJN)
KTHY_THEMA
[Raw transfer]




TYD_A_4(3HJN)
KTHY_THEMA
[Raw transfer]




ATM_B_4(4EAQ)
KTHY_STAAM
[Raw transfer]




THM_B_6(3N2I)
KTHY_VIBCH
[Raw transfer]




0Y5_A_3(4GSY)
KTHY_STAAR
[Raw transfer]




THM_A_4(3N2I)
KTHY_VIBCH
[Raw transfer]




ATM_B_8(4GMD)
KTHY_PSEAE
[Raw transfer]




ATM_C_12(4GMD)
KTHY_PSEAE
[Raw transfer]




TMP_A_4(4S35)
KTHY_AQUAE
[Raw transfer]




0YB_A_3(4GFD)
KTHY_STAAM
[Raw transfer]




ATM_A_3(4EAQ)
KTHY_STAAM
[Raw transfer]




ATM_A_3(4EAQ)
KTHY_STAAM
[Raw transfer]




0DJ_B_4(3UWO)
KTHY_PSEAE
[Raw transfer]




14D_A_3(4HEJ)
KTHY_STAAN
[Raw transfer]




0DF_B_5(3UWK)
KTHY_PSEAE
[Raw transfer]




0DJ_A_3(3UWO)
KTHY_PSEAE
[Raw transfer]




THM_A_2(4ESH)
KTHY_PSEAE
[Raw transfer]




0DN_C_11(3UXM)
KTHY_PSEAE
[Raw transfer]




0DN_A_7(3UXM)
KTHY_PSEAE
[Raw transfer]




0DF_A_3(3UWK)
KTHY_PSEAE
[Raw transfer]




0DN_B_8(3UXM)
KTHY_PSEAE
[Raw transfer]




MRD_A_3(3V9P)
KTHY_BURTA
[Raw transfer]




MRD_A_3(3V9P)
KTHY_BURTA
[Raw transfer]




0DN_D_12(3UXM)
KTHY_PSEAE
[Raw transfer]




ADP_A_4(4EDH)
KTHY_PSEAE
[Raw transfer]




MRD_B_7(3V9P)
KTHY_BURTA
[Raw transfer]




ADP_A_2(3LV8)
KTHY_VIBCH
[Raw transfer]




ADP_A_4(4EDH)
KTHY_PSEAE
[Raw transfer]




ADP_A_2(3LV8)
KTHY_VIBCH
[Raw transfer]




EDO_D_10(3LD9)
KTHY_EHRCR
[Raw transfer]




EDO_B_7(3LD9)
KTHY_EHRCR
[Raw transfer]




MES_A_3(4MQB)
KTHY_STAAM
[Raw transfer]




ACP_A_3(4S35)
KTHY_AQUAE
[Raw transfer]




ADP_B_9(4EDH)
KTHY_PSEAE
[Raw transfer]




ACP_B_8(4S35)
KTHY_AQUAE
[Raw transfer]




25 PsiBlast_CBE 96.3953% -96 - C2 -4DWJ - KTHY_STAAM -
5 PsiBlast_PDB 95.9953%-116 - C- -2CCJ - KTHY_STAAM -
24 PsiBlast_CBE 95.5553% -92 - C2 -4DWJ - KTHY_STAAM -
1 PsiBlast_PDB 95.5553% -96 - C2 -4DWJ - KTHY_STAAM -
18 PsiBlast_PDB 94.5153% -97 - C2 -4MQB 2.4 KTHY_STAAM
30 PsiBlast_CBE 94.2753%-108 - C2 -4QGH 9.0 KTHY_STAAR
21 PsiBlast_CBE 94.2053%-105 - C2 -4EAQ 6.9 KTHY_STAAM
26 PsiBlast_CBE 94.1753% -94 - C2 -4DWJ - KTHY_STAAM -
9 PsiBlast_PDB 93.7053%-107 - C2 -4HEJ 7.8 KTHY_STAAN
29 PsiBlast_CBE 93.6553%-107 - C2 -4XWA 9.1 KTHY_STAA1
28 PsiBlast_CBE 93.5853%-115 - C- -2CCG - KTHY_STAAM -
32 PsiBlast_CBE 93.4053%-105 - C2 -4QGA 8.2 KTHY_STAAR
31 PsiBlast_CBE 93.1953%-110 - C2 -4QGG 10.0 KTHY_STAAR
27 PsiBlast_CBE 92.8053% -93 - C2 -4DWJ - KTHY_STAAM -
36 PsiBlast_CBE 92.7053%-106 - C2 -4HDC 9.4 KTHY_STAAN
34 PsiBlast_CBE 92.6853%-105 - C2 -4HLD 8.1 KTHY_STAAR
17 PsiBlast_PDB 92.5953%-101 - C2 -4XWA 8.6 KTHY_STAA1
33 PsiBlast_CBE 92.4253%-105 - C2 -4QG7 8.0 KTHY_STAAR
128 HHSearch 92.0453%-101 * C2 *4EAQ 6.3 KTHY_STAAM
35 PsiBlast_CBE 91.9753%-105 - C2 -4HLC 8.5 KTHY_STAAR
12 PsiBlast_PDB 91.6253%-100 - C2 -4QG7 8.2 KTHY_STAAR
8 PsiBlast_PDB 91.4953%-103 - C2 -4HDC 9.3 KTHY_STAAN
7 PsiBlast_PDB 91.3753%-101 - C2 -4GSY 8.9 KTHY_STAAR
16 PsiBlast_PDB 91.3253% -95 - C2 -4QGH 9.3 KTHY_STAAR
15 PsiBlast_PDB 91.0653%-101 - C2 -4QGG 9.9 KTHY_STAAR
14 PsiBlast_PDB 90.9753%-102 - C2 -4QGF 8.7 KTHY_STAAR
11 PsiBlast_PDB 90.6853%-101 - C2 -4HLD 8.5 KTHY_STAAR
119 HHSearch 90.4053%-102 - C2 -4HLC 8.6 KTHY_STAAR
13 PsiBlast_PDB 90.3753% -98 - C2 -4QGA 9.0 KTHY_STAAR
2 PsiBlast_PDB 90.2153% -99 - C2 -4EAQ 6.3 KTHY_STAAM
10 PsiBlast_PDB 89.6553% -99 - C2 -4HLC 8.6 KTHY_STAAR
120 HHSearch 88.7340% -83 - C2 -4EDH 7.2 KTHY_PSEAE
6 PsiBlast_PDB 87.3453% -99 - C2 -4GFD 9.6 KTHY_STAAM
51 PsiBlast_CBE 85.1439%-100 - C2 -3HJN 5.2 KTHY_THEMA
65 PsiBlast_CBE 85.0234% -89 - C2 -4TMK 11.3 KTHY_ECOLI
64 PsiBlast_CBE 84.4034% -89 - C2 -5TMP 10.5 KTHY_ECOLI
129 HHSearch 84.2334% -89 - C2 -4TMK 10.8 KTHY_ECOLI
131 HHSearch 84.0439% -99 - C2 -3HJN 4.8 KTHY_THEMA
67 PsiBlast_CBE 83.8435% -83 - C2 -3N2I 5.5 KTHY_VIBCH
130 HHSearch 83.7736% -83 - C2 -3LV8 6.3 KTHY_VIBCH
139 Fugue 83.5834% -92 - C2 -4TMK 11.3 KTHY_ECOLI
68 PsiBlast_CBE 83.5635% -85 - C2 -3LV8 6.3 KTHY_VIBCH
66 PsiBlast_CBE 83.4935% -78 - C2 -3N2I 5.8 KTHY_VIBCH
122 HHSearch 82.4535% -97 - C2 -4S35 5.5 KTHY_AQUAE
58 PsiBlast_CBE 82.0235% -91 - C2 -4S35 7.0 KTHY_AQUAE
50 PsiBlast_CBE 81.8639% -97 - C2 -3HJN 6.1 KTHY_THEMA
59 PsiBlast_CBE 81.7335% -89 - C2 -4S35 6.7 KTHY_AQUAE
41 PsiBlast_CBE 79.3942% -72 - C2 -4EDH 6.2 KTHY_PSEAE
20 PsiBlast_PDB 79.0742% -78 - C2 -4ESH 3.8 KTHY_PSEAE
19 PsiBlast_PDB 79.0142% -71 - C2 -4EDH 6.6 KTHY_PSEAE
48 PsiBlast_CBE 78.4942% -74 - C2 -3UXM 4.5 KTHY_PSEAE
45 PsiBlast_CBE 77.6642% -77 - C2 -3UWK 4.4 KTHY_PSEAE
42 PsiBlast_CBE 77.3742% -83 - C2 -3UWO 5.1 KTHY_PSEAE
43 PsiBlast_CBE 77.3142% -81 - C2 -3UWO 4.5 KTHY_PSEAE
46 PsiBlast_CBE 77.2942% -77 - C2 -3UXM 3.7 KTHY_PSEAE
125 HHSearch 77.2638% -82 - C2 -3V9P 3.1 KTHY_BURTA
44 PsiBlast_CBE 77.2342% -81 - C2 -3UWK 5.1 KTHY_PSEAE
40 PsiBlast_CBE 76.8742% -79 - C2 -4GMD 4.9 KTHY_PSEAE
39 PsiBlast_CBE 76.0942% -78 - C2 -4GMD 5.8 KTHY_PSEAE
37 PsiBlast_CBE 76.0942% -84 - C2 -4GMD 5.9 KTHY_PSEAE
38 PsiBlast_CBE 76.0842% -84 - C2 -4GMD 5.3 KTHY_PSEAE
52 PsiBlast_CBE 75.4634% -84 - C2 -3LD9 2.6 KTHY_EHRCR
47 PsiBlast_CBE 75.1042% -77 - C2 -3UXM 4.6 KTHY_PSEAE
54 PsiBlast_CBE 74.9234% -90 - C2 -3LD9 2.6 KTHY_EHRCR
56 PsiBlast_CBE 74.9039% -79 - C2 -3V9P 3.1 KTHY_BURTA
57 PsiBlast_CBE 73.9639% -78 - C2 -3V9P 3.1 KTHY_BURTA
49 PsiBlast_CBE 72.3542% -80 - C2 -3UXM 4.1 KTHY_PSEAE