@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00290: (2016-06-01 )
MKLIVAVVQDQDSNRLLKTLTDHNFRVTKLATTGGFLKSGNTTFMIGVEDIRVNKALSLIKENGQKRDQMIAPVSPMGGNADSYVPYPVEVEVGGATVFVLPVDEFHQF

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2BA_C_7(4RWW)
?
[Raw transfer]




2BA_A_4(4RWW)
?
[Raw transfer]




2BA_B_6(4RWW)
?
[Raw transfer]




2BA_A_4(4RWW)
?
[Raw transfer]




2BA_B_5(4D3H)
?
[Raw transfer]




2BA_A_2(4WK1)
?
[Raw transfer]




2BA_A_2(4WK1)
?
[Raw transfer]




2BA_A_4(4D3H)
?
[Raw transfer]




2BA_C_6(4D3H)
?
[Raw transfer]




22 HHSearch 94.71100%-142 - C1 -4RLE - YAAQ_BACSU -
1 PsiBlast_PDB 94.71100%-142 - C1 -4RLE - YAAQ_BACSU -
21 PsiBlast_CBE 80.6466%-137 - C1 -4RWW 8.9 ?
23 HHSearch 80.2066%-129 - C1 -4RWW 8.7 ?
6 PsiBlast_PDB 80.2066%-129 - C1 -4RWW 8.7 ?
20 PsiBlast_CBE 80.0266%-138 - C1 -4RWW 8.9 ?
19 PsiBlast_CBE 75.7665%-126 - C1 -4D3H 7.1 ?
18 PsiBlast_CBE 74.5465%-132 - C1 -4D3H 8.3 ?
25 HHSearch 74.1751%-123 - C1 -3M05 - ? -
3 PsiBlast_PDB 73.7865%-139 - C1 -4WK3 - ? -
24 HHSearch 73.6465%-129 - C1 -4WK1 7.0 ?
2 PsiBlast_PDB 73.6465%-129 - C1 -4WK1 7.0 ?
5 PsiBlast_PDB 72.5165%-128 - C1 -4D3H 7.0 ?
7 PsiBlast_PDB 72.4366%-151 - C1 -4RWX - ? -
8 PsiBlast_PDB 71.6350%-126 - C1 -3M05 - ? -
4 PsiBlast_PDB 71.3565%-132 - C1 -4D3G - ? -
35 HHSearch 59.7825%-123 - C1 -3BZQ - GLNB_MYCTU -
30 HHSearch 58.1418%-114 - C1 -1HWU - ? -
27 HHSearch 56.4725%-118 - C1 -2GW8 - ? -
40 HHSearch 56.1619%-123 - C1 -4OZJ - ? -