@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00470: (2016-06-01 )
MKFRRSGRLVDLTNYLLTHPHELIPLTFFSERYESAKSSISEDLTIIKQTFEQQGIGTLLTVPGAAGGVKYIPKMKQAEAEEFVQTLGQSLANPERILPGGYVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPLAYAAASYLNVPVVIVRKDNKVTEGSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLVEAEGVDERLVDEYMSLLTLSTINMKEKSIEIQNGNFLRFFKDNLLKNGETES

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PCP_F_6(1P4A)
PURR_BACSU
[Raw transfer]




EPE_D_14(1O57)
PURR_BACSU
[Raw transfer]




PCP_F_6(1P4A)
PURR_BACSU
[Raw transfer]




EPE_A_13(1O57)
PURR_BACSU
[Raw transfer]




PCP_H_8(1P4A)
PURR_BACSU
[Raw transfer]




PCP_H_8(1P4A)
PURR_BACSU
[Raw transfer]




PPC_A_3(4WML)
PYRE_YEAST
[Raw transfer]




EPE_D_14(1O57)
PURR_BACSU
[Raw transfer]




EPE_A_13(1O57)
PURR_BACSU
[Raw transfer]




EPE_A_13(1O57)
PURR_BACSU
[Raw transfer]




21 PsiBlast_CBE 96.61100%-146 - C2 -1O57 2.0 PURR_BACSU
2 PsiBlast_PDB 96.50100%-150 - C2 -1P4A Error PURR_BACSU
22 PsiBlast_CBE 96.26100%-144 - C2 -1O57 Error PURR_BACSU
26 PsiBlast_CBE 96.19100%-147 - C2 -1P4A 5.1 PURR_BACSU
27 HHSearch 96.15100%-146 - C2 -1O57 2.2 PURR_BACSU
1 PsiBlast_PDB 96.15100%-146 - C2 -1O57 - PURR_BACSU -
49 Fugue 95.6499%-146 - C2 -1O57 2.2 PURR_BACSU
23 PsiBlast_CBE 95.54100%-143 - C2 -1O57 Error PURR_BACSU
25 PsiBlast_CBE 95.45100%-147 - C2 -1P4A Error PURR_BACSU
24 PsiBlast_CBE 94.58100%-143 - C2 -1P4A 4.1 PURR_BACSU
31 HHSearch 59.8427%-139 - C2 -4M0K - ? -
32 HHSearch 57.8322%-151 - C2 -1G2Q - APT1_YEAST -
29 HHSearch 57.5123%-132 - C2 -1Y0B - XPT_BACSU -
28 HHSearch 57.1624%-138 - C2 -4LZA - APT_THEP3 -
5 PsiBlast_PDB 56.8627%-126 - C2 -4M0K - ? -
52 Fugue 56.8223%-139 - C2 -1G2Q - APT1_YEAST -
48 HHSearch 55.8424%-143 * C2 *4X45 - APT_HUMAN -
12 PsiBlast_PDB 55.6326%-139 - C2 -4MB6 - APT_YERPS -
33 HHSearch 55.2923%-144 - C2 -2DY0 - APT_ECOLI -
38 HHSearch 55.2520%-122 - C2 -3DEZ - PYRE_STRMU -