@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00480: (2016-06-01 )
MTKAVHTKHAPAAIGPYSQGIIVNNMFYSSGQIPLTPSGEMVNGDIKEQTHQVFSNLKAVLEEAGASFETVVKATVFIADMEQFAEVNEVYGQYFDTHKPARSCVEVARLPKDALVEIEVIALVK

Atome Classification :

(36 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FLC_A_7(3MQW)
?
[Raw transfer]




FLC_E_21(3MQW)
?
[Raw transfer]




FLC_B_9(3MQW)
?
[Raw transfer]




FLC_D_17(3MQW)
?
[Raw transfer]




FLC_C_13(3MQW)
?
[Raw transfer]




BGC_B_5(3K0T)
?
[Raw transfer]




BGC_B_5(3K0T)
?
[Raw transfer]




BEZ_I_21(1ONI)
UK114_HUMAN
[Raw transfer]




BEZ_A_10(1ONI)
UK114_HUMAN
[Raw transfer]




BEZ_D_15(1ONI)
UK114_HUMAN
[Raw transfer]




BEZ_C_14(1ONI)
UK114_HUMAN
[Raw transfer]




BEZ_G_19(1ONI)
UK114_HUMAN
[Raw transfer]




BEZ_F_18(1ONI)
UK114_HUMAN
[Raw transfer]




GOL_C_15(3VCZ)
?
[Raw transfer]




BEZ_E_17(1ONI)
UK114_HUMAN
[Raw transfer]




BEZ_H_20(1ONI)
UK114_HUMAN
[Raw transfer]




GOL_A_6(3VCZ)
?
[Raw transfer]




GOL_B_11(3VCZ)
?
[Raw transfer]




BEZ_B_12(1ONI)
UK114_HUMAN
[Raw transfer]




51 Fugue 98.16100%-116 - C6 -1QD9 - RIDA_BACSU -
62 HHSearch 97.60100%-114 - C6 -1QD9 - RIDA_BACSU -
1 PsiBlast_PDB 97.60100%-114 - C6 -1QD9 - RIDA_BACSU -
22 PsiBlast_CBE 97.52100%-115 - C6 -1QD9 - RIDA_BACSU -
21 PsiBlast_CBE 97.02100%-115 - C6 -1QD9 - RIDA_BACSU -
6 PsiBlast_PDB 83.5854%-110 - C6 -2B33 - ? -
27 PsiBlast_CBE 83.1754%-110 - C6 -2B33 - ? -
77 HHSearch 82.6653%-109 - C6 -2B33 - ? -
67 HHSearch 81.8751%-108 - C6 -3QUW - MMF1_YEAST -
64 HHSearch 81.8158%-104 * C6 *1XRG - ? -
76 HHSearch 81.7555% -98 - C6 -3L7Q - ? -
42 PsiBlast_CBE 81.7251%-108 - C6 -3MQW 2.4 ?
26 PsiBlast_CBE 81.4958%-109 - C6 -1XRG - ? -
25 PsiBlast_CBE 81.4358%-106 - C6 -1XRG - ? -
7 PsiBlast_PDB 80.6252%-110 - C6 -3QUW - MMF1_YEAST -
5 PsiBlast_PDB 80.6055% -94 - C6 -3L7Q - ? -
2 PsiBlast_PDB 80.6058%-105 - C6 -1XRG - ? -
71 HHSearch 80.3855%-104 - C6 -2DYY - Y854_PYRHO -
39 PsiBlast_CBE 80.3351%-107 - C6 -3MQW 2.5 ?
8 PsiBlast_PDB 80.0952% -98 - C6 -1X25 - Y811_SULTO -
41 PsiBlast_CBE 79.9851%-106 - C6 -3MQW 2.5 ?
75 HHSearch 79.5258% -89 - C6 -3VCZ 2.8 ?
37 PsiBlast_CBE 78.9651%-107 - C6 -3MQW 2.4 ?
23 PsiBlast_CBE 77.7954% -93 - C6 -3VCZ 2.8 ?
40 PsiBlast_CBE 77.4551%-103 - C6 -3MQW 2.5 ?
29 PsiBlast_CBE 77.3044%-104 - C6 -1ONI 3.9 UK114_HUMAN
34 PsiBlast_CBE 76.7744%-105 - C6 -1ONI 4.0 UK114_HUMAN
30 PsiBlast_CBE 76.5544%-102 - C6 -1ONI 4.3 UK114_HUMAN
15 PsiBlast_PDB 76.0944%-103 - C6 -1ONI 3.2 UK114_HUMAN
33 PsiBlast_CBE 75.7844%-101 - C6 -1ONI 2.2 UK114_HUMAN
31 PsiBlast_CBE 75.6044%-102 - C6 -1ONI 3.0 UK114_HUMAN
35 PsiBlast_CBE 75.4144%-106 - C6 -1ONI 2.4 UK114_HUMAN
70 HHSearch 74.8146% -90 - C6 -3K0T 2.7 ?
32 PsiBlast_CBE 74.7444%-103 - C6 -1ONI 4.0 UK114_HUMAN
28 PsiBlast_CBE 74.2944%-104 - C6 -1ONI 3.2 UK114_HUMAN
18 PsiBlast_PDB 73.7849%-100 - C6 -3K0T 2.7 ?