@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00510: (2016-06-02 )
MSNQYGDKNLKIFSLNSNPELAKEIADIVGVQLGKCSVTRFSDGEVQINIEESIRGCDCYIIQSTSDPVNEHIMELLIMVDALKRASAKTINIVIPYYGYARQDRKARSREPITAKLFANLLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVPILGEYFEGKNLEDIVIVSPDHGGVTRARKLADRLKAPIAIIDKRRPRPNVAEVMNIVGNIEGKTAILIDDIIDTAGTITLAANALVENGAKEVYACCTHPVLSGPAVERINNSTIKELVVTNSIKLPEEKKIERFKQLSVGPLLAEAIIRVHEQQSVSYLFS

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ABM_F_6(1DKU)
KPRS_BACSU
[Raw transfer]




AMP_B_13(3DAH)
?
[Raw transfer]




AMP_B_12(2HCR)
PRPS1_HUMAN
[Raw transfer]




AMP_A_11(2HCR)
PRPS1_HUMAN
[Raw transfer]




ABM_E_5(1DKU)
KPRS_BACSU
[Raw transfer]




ABM_E_5(1DKU)
KPRS_BACSU
[Raw transfer]




AMP_A_11(3DAH)
?
[Raw transfer]




ADP_A_7(3LRT)
KPRS_THEVO
[Raw transfer]




AMP_B_12(3DAH)
?
[Raw transfer]




AMP_I_9(1U9Z)
KPRS_METJA
[Raw transfer]




CIT_A_4(1QB7)
?
[Raw transfer]




22 PsiBlast_CBE 98.29100%-164 - C7 -1DKR - KPRS_BACSU -
21 PsiBlast_CBE 98.19100%-167 - C7 -1DKU 3.2 KPRS_BACSU
50 HHSearch 97.93100%-166 - C7 -1DKU 2.9 KPRS_BACSU
1 PsiBlast_PDB 97.93100%-166 - C7 -1DKU - KPRS_BACSU -
71 Fugue 97.4699%-164 - C7 -1DKU 2.9 KPRS_BACSU
23 PsiBlast_CBE 87.3753%-149 - C7 -3DAH 3.1 ?
3 PsiBlast_PDB 87.0551%-149 - C7 -4S2U - ? -
51 HHSearch 86.8451%-146 - C7 -4S2U - ? -
24 PsiBlast_CBE 86.6653%-150 - C7 -3DAH 3.7 ?
34 PsiBlast_CBE 85.8347%-156 - C7 -4M0P - PRPS1_HUMAN -
2 PsiBlast_PDB 85.4253%-147 - C7 -3DAH - ? -
53 HHSearch 84.9853%-142 - C7 -3DAH 3.0 ?
6 PsiBlast_PDB 84.9447%-158 - C7 -4LYG - PRPS1_HUMAN -
13 PsiBlast_PDB 84.8647%-152 - C7 -4M0P - PRPS1_HUMAN -
52 HHSearch 84.6947%-152 * C7 *3S5J - PRPS1_HUMAN -
27 PsiBlast_CBE 84.5647%-156 - C7 -4LYG - PRPS1_HUMAN -
32 PsiBlast_CBE 84.5047%-149 - C7 -2H06 - PRPS1_HUMAN -
28 PsiBlast_CBE 84.4647%-152 - C7 -2H07 - PRPS1_HUMAN -
12 PsiBlast_PDB 84.3847%-153 - C7 -4LZN - PRPS1_HUMAN -
10 PsiBlast_PDB 84.3647%-155 - C7 -3EFH - PRPS1_HUMAN -
9 PsiBlast_PDB 84.2847%-153 - C7 -2HCR 4.2 PRPS1_HUMAN
31 PsiBlast_CBE 83.8847%-153 - C7 -2HCR 3.4 PRPS1_HUMAN
20 PsiBlast_PDB 67.8330%-153 - C7 -1U9Z 3.9 KPRS_METJA