@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00680: (2016-06-02 )
MMKHDIEKVLISEEEIQKKVKELGAELTSEYQDTFPLAIGVLKGALPFMADLIKHIDTYLEMDFMDVSSYGNSTVSSGEVKIIKDLDTSVEGRDILIIEDIIDSGLTLSYLVELFRYRKAKSIKIVTLLDKPSGRKADIKADFVGFEVPDAFVVGYGLDYAERYRNLPYIGVLKPAVYES

Atome Classification :

(94 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

3QG_A_7(4RHY)
HPRT_MYCTU
[Raw transfer]




3QG_D_16(4RHY)
HPRT_MYCTU
[Raw transfer]




3QF_A_5(4RHX)
HPRT_MYCTU
[Raw transfer]




3QF_A_5(4RHX)
HPRT_MYCTU
[Raw transfer]




3QF_C_11(4RHX)
HPRT_MYCTU
[Raw transfer]




3QF_D_14(4RHX)
HPRT_MYCTU
[Raw transfer]




3QG_C_13(4RHY)
HPRT_MYCTU
[Raw transfer]




45T_F_18(4RHU)
HPRT_MYCTU
[Raw transfer]




3QF_B_8(4RHX)
HPRT_MYCTU
[Raw transfer]




IMP_H_8(1P17)
?
[Raw transfer]




3QE_A_7(4RHU)
HPRT_MYCTU
[Raw transfer]




3QG_B_10(4RHY)
HPRT_MYCTU
[Raw transfer]




45T_C_12(4RHU)
HPRT_MYCTU
[Raw transfer]




5GP_B_15(3KB8)
?
[Raw transfer]




3L8_B_8(4RAQ)
HPRT_HUMAN
[Raw transfer]




3QE_B_9(4RHU)
HPRT_MYCTU
[Raw transfer]




IMP_H_8(1P19)
?
[Raw transfer]




3L7_A_5(4RAO)
HPRT_HUMAN
[Raw transfer]




3L7_D_14(4RAO)
HPRT_HUMAN
[Raw transfer]




3L8_A_5(4RAQ)
HPRT_HUMAN
[Raw transfer]




45T_D_14(4RHU)
HPRT_MYCTU
[Raw transfer]




5GP_A_2(3ACC)
?
[Raw transfer]




5GP_E_5(1G9T)
HPRT_ECOLI
[Raw transfer]




3L8_C_11(4RAQ)
HPRT_HUMAN
[Raw transfer]




PRP_B_10(1I0I)
?
[Raw transfer]




IMP_A_2(3ACD)
?
[Raw transfer]




IMP_E_5(1P19)
?
[Raw transfer]




PRP_B_10(1TC2)
?
[Raw transfer]




PRP_B_10(1I13)
?
[Raw transfer]




IMP_F_6(1P17)
?
[Raw transfer]




PRP_B_10(1I14)
?
[Raw transfer]




3L8_D_14(4RAQ)
HPRT_HUMAN
[Raw transfer]




PRP_B_10(1P18)
?
[Raw transfer]




PRP_B_9(1I0L)
?
[Raw transfer]




IMP_A_2(3ACD)
?
[Raw transfer]




IMP_E_5(1P17)
?
[Raw transfer]




IMP_G_7(1P17)
?
[Raw transfer]




IMP_G_7(1P19)
?
[Raw transfer]




5GP_B_4(1PZM)
?
[Raw transfer]




45T_E_16(4RHU)
HPRT_MYCTU
[Raw transfer]




IMP_F_6(1P19)
?
[Raw transfer]




5GP_D_4(1HGX)
HGXR_TRIFO
[Raw transfer]




4X7_A_5(5BSK)
HPRT_HUMAN
[Raw transfer]




5GP_D_4(1HGX)
HGXR_TRIFO
[Raw transfer]




5GP_A_3(1PZM)
?
[Raw transfer]




4X2_D_12(5BRN)
HPRT_HUMAN
[Raw transfer]




4X7_D_11(5BSK)
HPRT_HUMAN
[Raw transfer]




IMP_E_5(1G9S)
HPRT_ECOLI
[Raw transfer]




GOL_C_12(3O7M)
?
[Raw transfer]




5GP_A_3(1PZM)
?
[Raw transfer]




4X7_B_7(5BSK)
HPRT_HUMAN
[Raw transfer]




GOL_A_5(3O7M)
?
[Raw transfer]




4X7_C_9(5BSK)
HPRT_HUMAN
[Raw transfer]




5GP_A_9(3KB8)
?
[Raw transfer]




4X2_B_8(5BRN)
HPRT_HUMAN
[Raw transfer]




4X2_A_6(5BRN)
HPRT_HUMAN
[Raw transfer]




PRP_A_9(1TC2)
?
[Raw transfer]




PRP_A_9(1I14)
?
[Raw transfer]




PRP_A_9(1I0I)
?
[Raw transfer]




PRP_A_9(1P18)
?
[Raw transfer]




PRP_A_9(1I13)
?
[Raw transfer]




IMP_A_9(1YFZ)
?
[Raw transfer]




IMP_A_9(1YFZ)
?
[Raw transfer]




IMP_B_10(1YFZ)
?
[Raw transfer]




PRP_A_8(1I0L)
?
[Raw transfer]




GOL_A_7(4RQB)
?
[Raw transfer]




MES_B_7(3HVU)
?
[Raw transfer]




MES_A_5(3HVU)
?
[Raw transfer]




MES_C_9(3HVU)
?
[Raw transfer]




MES_A_5(3HVU)
?
[Raw transfer]




MES_D_11(3HVU)
?
[Raw transfer]




EPE_B_12(4QYI)
?
[Raw transfer]




FMB_D_4(1TC1)
?
[Raw transfer]




9DG_A_8(1FSG)
HGXR_TOXGO
[Raw transfer]




EPE_C_16(4QYI)
?
[Raw transfer]




FMB_C_3(1TC1)
?
[Raw transfer]




FMB_C_3(1TC1)
?
[Raw transfer]




5GP_A_6(4RHT)
HPRT_MYCTU
[Raw transfer]




SUC_B_10(3H83)
?
[Raw transfer]




7HP_A_7(1I0I)
?
[Raw transfer]




5GP_B_10(4RHT)
HPRT_MYCTU
[Raw transfer]




5GP_D_18(4RHT)
HPRT_MYCTU
[Raw transfer]




SUC_A_6(3H83)
?
[Raw transfer]




POP_A_6(3OZF)
?
[Raw transfer]




5GP_C_14(4RHT)
HPRT_MYCTU
[Raw transfer]




N_F_6(1G9T)
HPRT_ECOLI
[Raw transfer]




N_F_6(1G9S)
HPRT_ECOLI
[Raw transfer]




SUC_C_21(3KB8)
?
[Raw transfer]




SUC_D_25(3KB8)
?
[Raw transfer]




3 PsiBlast_PDB 91.7878%-155 - C3 -3KB8 5.5 ?
23 PsiBlast_CBE 91.5578%-153 - C3 -3KB8 5.7 ?
1 PsiBlast_PDB 91.3878%-152 - C3 -3H83 3.0 ?
29 PsiBlast_CBE 91.0778%-145 - C3 -3H83 4.4 ?
114 HHSearch 90.7379%-149 - C3 -3HVU 2.2 ?
2 PsiBlast_PDB 90.4578%-149 - C3 -3HVU 2.2 ?
21 PsiBlast_CBE 90.2078%-144 - C3 -3KB8 1.7 ?
26 PsiBlast_CBE 90.1578%-147 - C3 -3HVU 2.1 ?
27 PsiBlast_CBE 89.4878%-146 - C3 -3H83 - ? -
24 PsiBlast_CBE 89.2478%-147 - C3 -3HVU 2.3 ?
25 PsiBlast_CBE 88.9778%-145 - C3 -3HVU 2.0 ?
22 PsiBlast_CBE 88.5478%-144 - C3 -3KB8 2.5 ?
28 PsiBlast_CBE 87.9078%-143 - C3 -3H83 - ? -
6 PsiBlast_PDB 85.2760%-143 - C3 -1R3U - ? -
124 HHSearch 84.6461%-143 - C3 -1YFZ 5.2 ?
7 PsiBlast_PDB 84.3960%-143 - C3 -1YFZ 5.2 ?
117 HHSearch 84.3260%-143 - C3 -2GEB - ? -
8 PsiBlast_PDB 84.1060%-145 - C3 -2GEB - ? -
30 PsiBlast_CBE 83.9260%-144 - C3 -1YFZ 5.5 ?
31 PsiBlast_CBE 83.1960%-140 - C3 -1R3U - ? -
83 PsiBlast_CBE 82.9942%-145 - C3 -1I13 7.0 ?
77 PsiBlast_CBE 82.7742%-146 - C3 -1I0L 6.6 ?
79 PsiBlast_CBE 82.3642%-146 - C3 -1I14 6.5 ?
81 PsiBlast_CBE 82.2642%-144 - C3 -1I0I 6.9 ?
82 PsiBlast_CBE 82.0642%-143 - C3 -1I0I 4.3 ?
71 PsiBlast_CBE 81.9742%-144 - C3 -1P18 6.6 ?
5 PsiBlast_PDB 81.8858%-149 - C3 -4RQB 2.6 ?
63 PsiBlast_CBE 81.3843%-143 - C3 -1TC2 6.8 ?
84 PsiBlast_CBE 81.1142%-146 - C3 -1I13 3.1 ?
80 PsiBlast_CBE 80.5542%-142 - C3 -1I14 4.1 ?
69 PsiBlast_CBE 80.1743%-142 - C3 -1TC1 4.0 ?
78 PsiBlast_CBE 79.9842%-143 - C3 -1I0L 2.9 ?
45 PsiBlast_CBE 79.7448%-150 - C3 -4RHY 7.3 HPRT_MYCTU
68 PsiBlast_CBE 79.6143%-144 - C3 -1P19 3.8 ?
72 PsiBlast_CBE 79.5842%-145 - C3 -1P18 3.7 ?
74 PsiBlast_CBE 79.4942%-147 - C3 -1P17 4.1 ?
46 PsiBlast_CBE 79.3948%-154 - C3 -4RHY 7.3 HPRT_MYCTU
64 PsiBlast_CBE 79.3643%-146 - C3 -1TC2 4.3 ?
113 HHSearch 79.1549%-154 - C3 -4RHX 9.0 HPRT_MYCTU
76 PsiBlast_CBE 78.9842%-148 - C3 -1P17 4.7 ?
52 PsiBlast_CBE 78.7848%-155 - C3 -4RHX 9.0 HPRT_MYCTU
62 PsiBlast_CBE 78.7148%-154 - C3 -4RHT 3.3 HPRT_MYCTU
57 PsiBlast_CBE 78.2548%-152 - C3 -4RHU 6.0 HPRT_MYCTU
66 PsiBlast_CBE 78.0743%-147 - C3 -1P19 4.9 ?
128 HHSearch 78.0144%-149 - C3 -1TC1 3.2 ?
73 PsiBlast_CBE 78.0042%-148 - C3 -1P17 5.9 ?
50 PsiBlast_CBE 77.9048%-153 - C3 -4RHX 8.3 HPRT_MYCTU
75 PsiBlast_CBE 77.8842%-142 - C3 -1P17 6.3 ?
48 PsiBlast_CBE 77.6448%-151 - C3 -4RHY 7.9 HPRT_MYCTU
41 PsiBlast_CBE 77.6349%-142 - C3 -4QYI 2.0 ?
53 PsiBlast_CBE 77.4848%-153 - C3 -4RHU 5.9 HPRT_MYCTU
42 PsiBlast_CBE 77.2649%-141 - C3 -4QYI 2.3 ?
49 PsiBlast_CBE 77.1648%-151 - C3 -4RHX 8.4 HPRT_MYCTU
56 PsiBlast_CBE 77.0248%-152 - C3 -4RHU 6.1 HPRT_MYCTU
37 PsiBlast_CBE 76.7350%-157 - C3 -1G9T 3.2 HPRT_ECOLI
58 PsiBlast_CBE 76.5548%-146 - C3 -4RHU 5.7 HPRT_MYCTU
65 PsiBlast_CBE 76.4543%-156 - C3 -1P19 5.2 ?
47 PsiBlast_CBE 76.4548%-152 - C3 -4RHY 8.1 HPRT_MYCTU
15 PsiBlast_PDB 76.1450%-160 - C3 -1G9T 5.8 HPRT_ECOLI
33 PsiBlast_CBE 75.9449%-150 - C3 -3O7M 3.9 ?
10 PsiBlast_PDB 75.5049%-147 - C3 -3O7M 2.0 ?
70 PsiBlast_CBE 75.3543%-150 - C3 -1TC1 3.2 ?
54 PsiBlast_CBE 75.3148%-154 - C3 -4RHU 6.1 HPRT_MYCTU
61 PsiBlast_CBE 75.2148%-154 - C3 -4RHT 3.1 HPRT_MYCTU
55 PsiBlast_CBE 75.0048%-151 - C3 -4RHU 5.8 HPRT_MYCTU
51 PsiBlast_CBE 74.9648%-158 - C3 -4RHX 8.5 HPRT_MYCTU
59 PsiBlast_CBE 74.7348%-153 - C3 -4RHT 5.2 HPRT_MYCTU
60 PsiBlast_CBE 74.2448%-146 - C3 -4RHT 3.6 HPRT_MYCTU
126 HHSearch 74.1348%-146 - C3 -3ACD 6.1 ?
38 PsiBlast_CBE 73.7150%-152 - C3 -1G9S 3.1 HPRT_ECOLI
17 PsiBlast_PDB 73.7148%-142 - C3 -1HGX 6.6 HGXR_TRIFO
67 PsiBlast_CBE 73.3943%-144 - C3 -1P19 5.7 ?
20 PsiBlast_PDB 73.2449%-157 - C3 -3ACD 6.1 ?
19 PsiBlast_PDB 73.1949%-155 - C3 -3ACC 6.4 ?
119 HHSearch 73.0739%-150 * C3 *1PZM 6.2 ?
14 PsiBlast_PDB 72.9150%-156 - C3 -1G9S 5.1 HPRT_ECOLI
101 Fugue 72.8547%-138 - C3 -1HGX 6.4 HGXR_TRIFO
125 HHSearch 71.5332%-134 - C3 -3OZF 3.3 ?
100 PsiBlast_CBE 71.4737%-147 - C3 -4RAO 6.4 HPRT_HUMAN
118 HHSearch 69.7838%-149 - C3 -4RAO 7.9 HPRT_HUMAN
99 PsiBlast_CBE 69.3937%-152 - C3 -4RAQ 6.3 HPRT_HUMAN
96 PsiBlast_CBE 69.0737%-154 - C3 -4RAQ 6.8 HPRT_HUMAN
88 PsiBlast_CBE 69.0038%-152 - C3 -1PZM 6.2 ?
98 PsiBlast_CBE 68.6937%-157 - C3 -4RAQ 5.7 HPRT_HUMAN
97 PsiBlast_CBE 68.2637%-150 - C3 -4RAQ 5.4 HPRT_HUMAN
91 PsiBlast_CBE 68.0437%-154 - C3 -5BSK 5.9 HPRT_HUMAN
90 PsiBlast_CBE 68.0237%-152 - C3 -5BSK 5.5 HPRT_HUMAN
93 PsiBlast_CBE 67.8637%-152 - C3 -5BRN 4.7 HPRT_HUMAN
123 HHSearch 67.8230%-128 - C3 -1FSG 3.7 HGXR_TOXGO
94 PsiBlast_CBE 67.7937%-152 - C3 -5BRN 5.2 HPRT_HUMAN
95 PsiBlast_CBE 67.5537%-153 - C3 -5BRN 5.5 HPRT_HUMAN
87 PsiBlast_CBE 66.6938%-156 - C3 -1PZM 7.0 ?
89 PsiBlast_CBE 66.5537%-158 - C3 -5BSK 6.1 HPRT_HUMAN
92 PsiBlast_CBE 65.7337%-150 - C3 -5BSK 5.3 HPRT_HUMAN