@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00710: (2016-06-02 )
MDYLVKALAYDGKVRAYAARTTDMVNEGQRRHGTWPTASAALGRTMTASLMLGAMLKGDDKLTVKIEGGGPIGAIVADANAKGEVRAYVSNPQVHFDLNEQGKLDVRRAVGTNGTLSVVKDLGLREFFTGQVEIVSGELGDDFTYYLVSSEQVPSSVGVGVLVNPDNTILAAGGFIIQLMPGTDDETITKIEQRLSQVEPISKLIQKGLTPEEILEEVLGEKPEILETMPVRFHCPCSKERFETAILGLGKKEIQDMIEEDGQAEAVCHFCNEKYLFTKEELEGLRDQTTR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

UNL_A_7(1VQ0)
HSLO_THEMA
[Raw transfer]




UNL_A_7(1VQ0)
HSLO_THEMA
[Raw transfer]




UNL_B_8(1VQ0)
HSLO_THEMA
[Raw transfer]




23 HHSearch 99.4499%-100 - C4 -1VZY - HSLO_BACSU -
1 PsiBlast_PDB 99.4199% -99 - C4 -1VZY - HSLO_BACSU -
21 PsiBlast_CBE 97.4799%-104 - C4 -1VZY - HSLO_BACSU -
24 HHSearch 81.8439%-100 - C4 -1VQ0 4.2 HSLO_THEMA
22 PsiBlast_CBE 78.7140% -97 - C4 -1VQ0 4.2 HSLO_THEMA
2 PsiBlast_PDB 78.4340% -97 - C4 -1VQ0 4.2 HSLO_THEMA
5 PsiBlast_PDB 61.0023% -74 - C4 -3M7M - HSLO_ECOLI -
26 HHSearch 59.1824% -80 - C4 -1HW7 - HSLO_ECOLI -
4 PsiBlast_PDB 59.1023% -76 - C4 -1HW7 - HSLO_ECOLI -
25 HHSearch 58.7525% -75 - C4 -1I7F - HSLO_ECOLI -
3 PsiBlast_PDB 58.4624% -73 - C4 -1I7F - HSLO_ECOLI -
43 Fugue 56.5521% -59 - C4 -1I7F - HSLO_ECOLI -
44 Fugue 42.4432% -69 - C4 -1XJH - -
6 PsiBlast_PDB 42.4432% -69 - C4 -1XJH - -
46 Fugue 41.1922% -52 - C3 -4QW2 - FMR1_HUMAN -
45 Fugue 37.6118% -13 - C2 -3P4G - ? -
51 Fugue 35.1219% 82 - C4 -1F93 - HNF1A_MOUSE -
50 Fugue 35.1028% 85 - C4 -1G39 - HNF1A_MOUSE -
48 Fugue 34.9127% 88 * C4 *1G39 - HNF1A_MOUSE -
40 HHSearch 34.7418% -22 - C4 -2JR7 - DPH3_HUMAN -