@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00780: (2016-06-02 )
MDKVYVEGMEFYGYHGVFTEENKLGQRFKVDLTAELDLSKAGQTDDLEQTINYAELYHVCKDIVEGEPVKLVETLAERIAGTVLGKFQPVQQCTVKVIKPDPPIPGHYKSVAIEITRKKS

Atome Classification :

(40 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NEU_A_5(2NM2)
FOLB_STAAU
[Raw transfer]




204_I_9(1RRY)
FOLB_STAAU
[Raw transfer]




45P_A_2(1RS4)
FOLB_STAAU
[Raw transfer]




MPU_A_3(2NM3)
FOLB_STAAU
[Raw transfer]




NEU_B_6(2NM2)
FOLB_STAAU
[Raw transfer]




NEU_C_7(2NM2)
FOLB_STAAU
[Raw transfer]




PH2_H_14(1NBU)
FOLB_MYCTU
[Raw transfer]




PSB_I_9(1RSD)
FOLB_STAAU
[Raw transfer]




NPR_I_9(1U68)
FOLB_STAAU
[Raw transfer]




PH2_I_9(2DHN)
FOLB_STAAU
[Raw transfer]




9MG_I_9(1RRW)
FOLB_STAAU
[Raw transfer]




NEU_D_8(2NM2)
FOLB_STAAU
[Raw transfer]




NEU_A_3(5F3M)
?
[Raw transfer]




NEU_B_8(5F3M)
?
[Raw transfer]




209_I_9(1RS2)
FOLB_STAAU
[Raw transfer]




977_A_2(1RSI)
FOLB_STAAU
[Raw transfer]




PH2_C_9(1NBU)
FOLB_MYCTU
[Raw transfer]




PH2_A_12(1NBU)
FOLB_MYCTU
[Raw transfer]




PH2_A_12(1NBU)
FOLB_MYCTU
[Raw transfer]




9MG_H_16(5FAR)
?
[Raw transfer]




9MG_C_12(5FAR)
?
[Raw transfer]




PH2_F_15(1NBU)
FOLB_MYCTU
[Raw transfer]




PH2_E_16(1NBU)
FOLB_MYCTU
[Raw transfer]




PH2_D_10(1NBU)
FOLB_MYCTU
[Raw transfer]




9MG_B_10(5FAR)
?
[Raw transfer]




9MG_E_13(5FAR)
?
[Raw transfer]




NEU_A_3(5F3M)
?
[Raw transfer]




PH2_G_13(1NBU)
FOLB_MYCTU
[Raw transfer]




PH2_B_11(1NBU)
FOLB_MYCTU
[Raw transfer]




9MG_A_9(5FAR)
?
[Raw transfer]




9MG_F_14(5FAR)
?
[Raw transfer]




9MG_G_15(5FAR)
?
[Raw transfer]




9MG_C_11(5FAR)
?
[Raw transfer]




8 PsiBlast_PDB 85.5247%-115 - C5 -1RSD 4.4 FOLB_STAAU
4 PsiBlast_PDB 85.4347%-115 - C5 -1RRW 3.0 FOLB_STAAU
58 HHSearch 85.1747%-117 - C5 -1DHN - FOLB_STAAU -
11 PsiBlast_PDB 85.1147%-119 - C5 -1DHN - FOLB_STAAU -
10 PsiBlast_PDB 84.9747%-117 - C5 -1U68 2.9 FOLB_STAAU
7 PsiBlast_PDB 84.9647%-114 - C5 -1RS4 3.9 FOLB_STAAU
3 PsiBlast_PDB 84.9347%-114 - C5 -1RRI - FOLB_STAAU -
5 PsiBlast_PDB 84.5647%-120 - C5 -1RRY 2.4 FOLB_STAAU
6 PsiBlast_PDB 84.5547%-117 - C5 -1RS2 3.3 FOLB_STAAU
12 PsiBlast_PDB 84.3047%-116 - C5 -2DHN 3.7 FOLB_STAAU
9 PsiBlast_PDB 83.5747%-118 - C5 -1RSI 5.2 FOLB_STAAU
14 PsiBlast_PDB 82.7247%-112 - C5 -2NM3 3.3 FOLB_STAAU
41 PsiBlast_CBE 82.6241%-112 - C5 -1SQL - FOLB1_ARATH -
31 PsiBlast_CBE 82.3947%-112 - C5 -2NM2 4.5 FOLB_STAAU
30 PsiBlast_CBE 81.9247%-120 - C5 -2NM2 3.9 FOLB_STAAU
29 PsiBlast_CBE 81.1747%-116 - C5 -2NM2 2.4 FOLB_STAAU
39 PsiBlast_CBE 81.0941%-114 - C5 -1SQL - FOLB1_ARATH -
32 PsiBlast_CBE 80.7841%-113 - C5 -1SQL - FOLB1_ARATH -
13 PsiBlast_PDB 80.3947%-115 - C5 -2NM2 3.0 FOLB_STAAU
40 PsiBlast_CBE 80.3741%-116 - C5 -1SQL - FOLB1_ARATH -
52 PsiBlast_CBE 77.9538%-104 - C5 -1NBU 5.6 FOLB_MYCTU
50 PsiBlast_CBE 77.6938%-108 - C5 -1NBU 3.5 FOLB_MYCTU
47 PsiBlast_CBE 77.4438%-104 - C5 -1NBU 3.7 FOLB_MYCTU
53 PsiBlast_CBE 77.1838%-101 - C5 -1NBU 3.8 FOLB_MYCTU
48 PsiBlast_CBE 77.1638%-110 - C5 -1NBU 3.5 FOLB_MYCTU
62 HHSearch 77.1338%-101 - C5 -1NBU 5.6 FOLB_MYCTU
16 PsiBlast_PDB 76.5838%-101 - C5 -1NBU 4.3 FOLB_MYCTU
49 PsiBlast_CBE 75.9938%-107 - C5 -1NBU 4.1 FOLB_MYCTU
51 PsiBlast_CBE 74.0638%-109 - C5 -1NBU 3.4 FOLB_MYCTU
56 HHSearch 68.7763% -5 - C5 -5F3M 3.6 ?
27 PsiBlast_CBE 66.2061% 20 - C5 -5FAR 2.2 ?
22 PsiBlast_CBE 65.7361% 20 - C5 -5FAR 2.8 ?
26 PsiBlast_CBE 65.5961% 24 - C5 -5FAR 2.8 ?
25 PsiBlast_CBE 65.1061% 30 - C5 -5FAR 2.7 ?
21 PsiBlast_CBE 64.8161% 23 - C5 -5FAR 2.7 ?
2 PsiBlast_PDB 64.7161% 24 - C5 -5FAR 2.8 ?
24 PsiBlast_CBE 64.5861% 15 - C5 -5FAR 2.6 ?
28 PsiBlast_CBE 64.3961% 30 - C5 -5F3M 3.5 ?
1 PsiBlast_PDB 64.3361% 29 - C5 -5F3M 3.5 ?
23 PsiBlast_CBE 64.1561% 25 - C5 -5FAR 2.7 ?