@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00790: (2016-06-02 )
MNNIAYIALGSNIGDRETYLRQAVALLHQHAAVTVTKVSSIYETDPVGYEDQAQFLNMAVEIKTSLNPFELLELTQQIENELGRTREVRWGPRTADLDILLFNRENIETEQLIVPHPRMYERLFVLAPLAEICQQVEKEATSAETDQEGVRVWKQKSGVDEFVHSES

Atome Classification :

(62 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

A4P_A_4(1EX8)
HPPK_ECOLI
[Raw transfer]




J1C_A_2(3UDV)
HPPK_ECOLI
[Raw transfer]




J1B_A_2(3UDE)
HPPK_ECOLI
[Raw transfer]




J1D_A_2(4F7V)
HPPK_ECOLI
[Raw transfer]




J1A_A_2(3UD5)
HPPK_ECOLI
[Raw transfer]




APC_A_9(1Q0N)
HPPK_ECOLI
[Raw transfer]




APC_B_9(4M5N)
HPPK_ECOLI
[Raw transfer]




APC_C_15(4CYU)
?
[Raw transfer]




APC_A_5(1F9H)
HPPK_ECOLI
[Raw transfer]




APC_A_9(1Q0N)
HPPK_ECOLI
[Raw transfer]




APC_A_5(4M5N)
HPPK_ECOLI
[Raw transfer]




APC_A_4(3HD2)
HPPK_ECOLI
[Raw transfer]




APC_A_4(3HT0)
HPPK_ECOLI
[Raw transfer]




APC_A_2(3KUH)
HPPK_ECOLI
[Raw transfer]




APC_B_17(1TMM)
HPPK_ECOLI
[Raw transfer]




APC_A_4(3IP0)
HPPK_ECOLI
[Raw transfer]




APC_B_10(3MCO)
?
[Raw transfer]




APC_A_15(1TMM)
HPPK_ECOLI
[Raw transfer]




APC_A_9(1HQ2)
HPPK_ECOLI
[Raw transfer]




APC_A_3(3ILO)
HPPK_ECOLI
[Raw transfer]




APC_A_4(3IP0)
HPPK_ECOLI
[Raw transfer]




APC_A_4(3HSG)
HPPK_ECOLI
[Raw transfer]




APC_A_4(3HD1)
HPPK_ECOLI
[Raw transfer]




APC_A_5(4M5I)
HPPK_ECOLI
[Raw transfer]




APC_A_7(4CYU)
?
[Raw transfer]




APC_A_2(4M5L)
HPPK_ECOLI
[Raw transfer]




APC_A_2(4M5J)
HPPK_ECOLI
[Raw transfer]




ATP_A_2(1DY3)
HPPK_ECOLI
[Raw transfer]




APC_A_2(4M5K)
HPPK_ECOLI
[Raw transfer]




APC_A_2(4M5H)
HPPK_ECOLI
[Raw transfer]




APC_A_2(4M5G)
HPPK_ECOLI
[Raw transfer]




APC_A_3(3ILJ)
HPPK_ECOLI
[Raw transfer]




APC_A_8(1RU1)
HPPK_ECOLI
[Raw transfer]




APC_A_4(4CWB)
?
[Raw transfer]




APC_A_4(4CWB)
?
[Raw transfer]




APC_A_3(4M5M)
HPPK_ECOLI
[Raw transfer]




APC_B_10(1RU1)
HPPK_ECOLI
[Raw transfer]




APC_A_2(4CRJ)
?
[Raw transfer]




APC_A_5(1RU2)
HPPK_ECOLI
[Raw transfer]




APC_B_11(4CYU)
?
[Raw transfer]




APC_D_18(4CYU)
?
[Raw transfer]




ADP_A_4(1EQM)
HPPK_ECOLI
[Raw transfer]




GOL_B_15(3HSD)
HPPK_ECOLI
[Raw transfer]




AMP_A_2(1RAO)
HPPK_ECOLI
[Raw transfer]




GOL_A_10(3HSD)
HPPK_ECOLI
[Raw transfer]




GOL_A_9(3HSD)
HPPK_ECOLI
[Raw transfer]




PMM_A_3(2BMB)

[Raw transfer]




PMM_A_3(2BMB)

[Raw transfer]




HH2_A_2(1RB0)
HPPK_ECOLI
[Raw transfer]




GSY_B_4(4AD6)
?
[Raw transfer]




GOL_A_9(1RTZ)
HPPK_ECOLI
[Raw transfer]




GSY_A_3(4AD6)
?
[Raw transfer]




GOL_A_5(3HSJ)
HPPK_ECOLI
[Raw transfer]




B55_A_3(3QBC)
?
[Raw transfer]




ROI_E_5(1CBK)
HPPK_HAEIN
[Raw transfer]




B55_B_4(3QBC)
?
[Raw transfer]




HH2_A_3(1RAO)
HPPK_ECOLI
[Raw transfer]




ROI_E_5(1CBK)
HPPK_HAEIN
[Raw transfer]




ROI_F_6(1CBK)
HPPK_HAEIN
[Raw transfer]




B57_B_5(3MCN)
?
[Raw transfer]




EDO_A_4(3UD5)
HPPK_ECOLI
[Raw transfer]




TRS_A_3(3HSZ)
HPPK_ECOLI
[Raw transfer]




TRS_A_3(3HCX)
HPPK_ECOLI
[Raw transfer]




TRS_A_4(3HSZ)
HPPK_ECOLI
[Raw transfer]




EDO_A_3(3UD5)
HPPK_ECOLI
[Raw transfer]




APC_B_8(2QX0)
?
[Raw transfer]




1 PsiBlast_PDB 92.1152%-135 - C6 -3QBC 3.8 ?
24 PsiBlast_CBE 91.5752%-140 - C6 -3QBC 3.4 ?
4 PsiBlast_PDB 91.3352%-130 - C6 -4CWB 7.5 ?
3 PsiBlast_PDB 90.9052%-128 - C6 -4CRJ 7.6 ?
23 PsiBlast_CBE 90.8852%-138 - C6 -4AD6 3.9 ?
82 Fugue 90.7643% -90 - C6 -1Q0N 7.1 HPPK_ECOLI
22 PsiBlast_CBE 90.1852%-129 - C6 -4CYU 6.6 ?
2 PsiBlast_PDB 89.9452%-137 - C6 -4AD6 3.7 ?
21 PsiBlast_CBE 89.8252%-127 - C6 -4CYU 4.3 ?
5 PsiBlast_PDB 89.5252%-130 - C6 -4CYU 4.9 ?
72 HHSearch 88.8949%-112 - C6 -4CWB 7.5 ?
29 PsiBlast_CBE 87.9647%-139 - C6 -3UDE 8.7 HPPK_ECOLI
35 PsiBlast_CBE 87.9247%-131 - C6 -3KUE - HPPK_ECOLI -
38 PsiBlast_CBE 87.8147%-132 - C6 -3HSD 2.1 HPPK_ECOLI
25 PsiBlast_CBE 87.8152%-135 - C6 -4CYU 6.9 ?
28 PsiBlast_CBE 87.3247%-139 - C6 -3UDV 8.2 HPPK_ECOLI
39 PsiBlast_CBE 87.2947%-131 - C6 -3HD2 5.3 HPPK_ECOLI
53 PsiBlast_CBE 87.2747%-133 - C6 -3HT0 5.3 HPPK_ECOLI
37 PsiBlast_CBE 87.0047%-134 - C6 -3HSD 2.9 HPPK_ECOLI
31 PsiBlast_CBE 86.9447%-128 - C6 -3IP0 7.6 HPPK_ECOLI
36 PsiBlast_CBE 86.8947%-132 - C6 -3HSG 6.2 HPPK_ECOLI
10 PsiBlast_PDB 86.5847%-131 - C6 -4M5J 6.6 HPPK_ECOLI
26 PsiBlast_CBE 86.5247%-124 - C6 -4M5N 6.3 HPPK_ECOLI
73 HHSearch 86.4646%-115 - C6 -3IP0 7.6 HPPK_ECOLI
15 PsiBlast_PDB 86.3147%-123 - C6 -1DY3 6.9 HPPK_ECOLI
32 PsiBlast_CBE 86.3047%-128 - C6 -1RB0 4.6 HPPK_ECOLI
12 PsiBlast_PDB 86.2147%-128 - C6 -4M5L 7.0 HPPK_ECOLI
45 PsiBlast_CBE 86.1447%-125 - C6 -1F9H 7.6 HPPK_ECOLI
13 PsiBlast_PDB 86.0947%-126 - C6 -4M5M 7.4 HPPK_ECOLI
14 PsiBlast_PDB 86.0047%-125 - C6 -4M5N 6.7 HPPK_ECOLI
11 PsiBlast_PDB 85.9147%-126 - C6 -4M5K 7.0 HPPK_ECOLI
20 PsiBlast_PDB 85.8947%-132 - C6 -1RAO 4.8 HPPK_ECOLI
9 PsiBlast_PDB 85.8247%-126 - C6 -4M5I 7.0 HPPK_ECOLI
19 PsiBlast_PDB 85.7947%-125 - C6 -1Q0N 7.1 HPPK_ECOLI
16 PsiBlast_PDB 85.7747%-125 - C6 -1EX8 9.2 HPPK_ECOLI
55 PsiBlast_CBE 85.7247%-125 - C6 -3KUH 6.5 HPPK_ECOLI
57 PsiBlast_CBE 85.6347%-124 * C6 *1TMM 5.6 HPPK_ECOLI
8 PsiBlast_PDB 85.6247%-126 - C6 -4M5H 7.0 HPPK_ECOLI
7 PsiBlast_PDB 85.5547%-125 - C6 -4M5G 6.8 HPPK_ECOLI
27 PsiBlast_CBE 85.4347%-128 - C6 -4F7V 9.6 HPPK_ECOLI
46 PsiBlast_CBE 85.4247%-126 - C6 -3ILO 7.1 HPPK_ECOLI
51 PsiBlast_CBE 85.3547%-137 - C6 -3HD1 5.4 HPPK_ECOLI
59 PsiBlast_CBE 85.3345%-144 - C6 -1RU2 4.7 HPPK_ECOLI
56 PsiBlast_CBE 85.2147%-122 - C6 -1TMM 5.8 HPPK_ECOLI
42 PsiBlast_CBE 84.9747%-122 - C6 -1HQ2 6.6 HPPK_ECOLI
54 PsiBlast_CBE 84.9247%-133 - C6 -3HSZ 3.4 HPPK_ECOLI
30 PsiBlast_CBE 84.8947%-136 - C6 -3UD5 7.1 HPPK_ECOLI
48 PsiBlast_CBE 84.7747%-128 - C6 -3ILJ 4.7 HPPK_ECOLI
60 PsiBlast_CBE 84.5345%-135 - C6 -1RU1 4.8 HPPK_ECOLI
17 PsiBlast_PDB 84.4547%-129 - C6 -1EQM 3.5 HPPK_ECOLI
34 PsiBlast_CBE 83.7843%-123 - C6 -1CBK 3.4 HPPK_HAEIN
62 PsiBlast_CBE 83.7245%-138 - C6 -1RTZ 2.6 HPPK_ECOLI
50 PsiBlast_CBE 83.7247%-137 - C6 -3HSJ 1.9 HPPK_ECOLI
52 PsiBlast_CBE 83.6247%-134 - C6 -3HCX 2.8 HPPK_ECOLI
70 HHSearch 82.5241%-107 - C6 -1CBK 3.4 HPPK_HAEIN
61 PsiBlast_CBE 82.2345%-146 - C6 -1RU1 4.9 HPPK_ECOLI
76 HHSearch 82.0642%-117 - C6 -2BMB 4.7
33 PsiBlast_CBE 81.7043%-122 - C6 -1CBK 3.5 HPPK_HAEIN
71 HHSearch 80.4740%-100 - C6 -2QX0 3.4 ?
6 PsiBlast_PDB 77.5343%-118 - C6 -2BMB 4.7
66 PsiBlast_CBE 75.5135%-130 - C6 -3MCN 4.7 ?
64 PsiBlast_CBE 75.0335%-142 - C6 -3MCO 5.6 ?