@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00900: (2016-06-02 )
MSYDVVIPAAGQGKRMKAGRNKLFIELKGDPVIIHTLRVFDSHRQCDKIILVINEQEREHFQQLLSDYPFQTSIELVAGGDERQHSVYKGLKAVKQEKIVLVHDGARPFIKHEQIDELIAEAEQTGAAILAVPVKDTIKRVQDLQVSETIERSSLWAVQTPQAFRLSLLMKAHAEAERKGFLGTDDASLVEQMEGGSVRVVEGSYTNIKLTTPDDLTSAEAIMESESGNKHV

Atome Classification :

(37 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CTP_A_5(1VPA)
ISPD_THEMA
[Raw transfer]




CTP_A_5(1VPA)
ISPD_THEMA
[Raw transfer]




CTP_B_5(3Q7U)
ISPD_MYCTU
[Raw transfer]




CTP_A_4(3Q7U)
ISPD_MYCTU
[Raw transfer]




CTP_A_4(1I52)
ISPD_ECOLI
[Raw transfer]




CTP_A_4(1I52)
ISPD_ECOLI
[Raw transfer]




CTP_B_6(2XWN)
ISPD_MYCTU
[Raw transfer]




CDM_A_3(1INI)
ISPD_ECOLI
[Raw transfer]




CTP_A_4(2XWL)
?
[Raw transfer]




CTP_A_4(1I52)
ISPD_ECOLI
[Raw transfer]




CTP_B_6(1VPA)
ISPD_THEMA
[Raw transfer]




CTP_A_4(2XWL)
?
[Raw transfer]




CDM_A_3(1INI)
ISPD_ECOLI
[Raw transfer]




CTP_B_6(2XWL)
?
[Raw transfer]




CTP_A_5(4ZDQ)
ISPD_BURTA
[Raw transfer]




CTP_A_5(4ZDQ)
ISPD_BURTA
[Raw transfer]




CDM_A_3(3Q80)
ISPD_MYCTU
[Raw transfer]




CDM_B_7(3Q80)
ISPD_MYCTU
[Raw transfer]




C5P_A_3(2XWM)
?
[Raw transfer]




CTP_D_16(4ZDQ)
ISPD_BURTA
[Raw transfer]




C5P_B_4(2XWM)
?
[Raw transfer]




C5P_A_7(1W77)
ISPD_ARATH
[Raw transfer]




MW5_A_2(2YC3)
ISPD_ARATH
[Raw transfer]




PGR_B_5(3N9W)
ISPD_ECOLI
[Raw transfer]




ACY_B_8(1VPA)
ISPD_THEMA
[Raw transfer]




ACY_A_7(1VPA)
ISPD_THEMA
[Raw transfer]




48 HHSearch 93.8838%-107 - C1 -2YC3 7.6 ISPD_ARATH
2 PsiBlast_PDB 93.6937%-104 - C1 -2YC5 - ISPD_ARATH -
7 PsiBlast_PDB 93.0937%-107 - C1 -4NAI - ISPD_ARATH -
1 PsiBlast_PDB 92.4737%-102 - C1 -2YC3 - ISPD_ARATH -
6 PsiBlast_PDB 91.0537%-112 - C1 -1W77 3.3 ISPD_ARATH
8 PsiBlast_PDB 90.6237%-107 - C1 -2YCM - ISPD_ARATH -
14 PsiBlast_PDB 90.3335% -87 - C1 -4YS8 - ISPD_BURTA -
5 PsiBlast_PDB 89.9337%-108 - C1 -4NAN - ISPD_ARATH -
3 PsiBlast_PDB 89.9237%-111 - C1 -4NAK - ISPD_ARATH -
4 PsiBlast_PDB 89.6437%-109 - C1 -4NAL - ISPD_ARATH -
39 Fugue 88.8125% -99 - C1 -4CVH - ISPD_HUMAN -
55 HHSearch 88.5134% -88 - C1 -4ZDQ 7.4 ISPD_BURTA
47 HHSearch 87.9127%-105 - C1 -4CVH - ISPD_HUMAN -
25 PsiBlast_CBE 87.4335% -97 - C1 -4ZDQ 2.1 ISPD_BURTA
26 PsiBlast_CBE 86.3335% -89 - C1 -4YS8 - ISPD_BURTA -
64 HHSearch 86.3236% -99 - C1 -2PX7 - ISPD_THET8 -
38 Fugue 86.3035% -90 - C1 -1INI 7.8 ISPD_ECOLI
13 PsiBlast_PDB 86.0635% -98 - C1 -2PX7 - ISPD_THET8 -
24 PsiBlast_CBE 85.9636% -96 - C1 -2XWL 7.7 ?
17 PsiBlast_PDB 85.7132% -92 - C1 -1VPA 6.7 ISPD_THEMA
15 PsiBlast_PDB 85.7035% -81 - C1 -4ZDQ 7.4 ISPD_BURTA
37 Fugue 84.9535% -89 - C1 -1I52 7.4 ISPD_ECOLI
11 PsiBlast_PDB 84.9436% -92 - C1 -2XWL 8.3 ?
12 PsiBlast_PDB 84.7036% -96 - C1 -2XWM 5.6 ?
58 HHSearch 84.4131% -90 - C1 -1VPA 6.7 ISPD_THEMA
56 HHSearch 84.1836% -90 - C1 -2XWL 8.3 ?
10 PsiBlast_PDB 84.0936% -86 - C1 -1INI 7.8 ISPD_ECOLI
51 HHSearch 83.4735% -88 - C1 -1I52 7.3 ISPD_ECOLI
9 PsiBlast_PDB 83.4036% -86 - C1 -1I52 7.4 ISPD_ECOLI
27 PsiBlast_CBE 82.2832% -94 - C1 -1VPA 6.9 ISPD_THEMA
21 PsiBlast_CBE 81.8936% -88 - C1 -3N9W 4.1 ISPD_ECOLI
23 PsiBlast_CBE 81.5736% -94 - C1 -2XWM 4.5 ?
19 PsiBlast_PDB 79.0134% -92 - C1 -3Q80 7.4 ISPD_MYCTU
28 PsiBlast_CBE 77.6834% -88 - C1 -3Q80 7.1 ISPD_MYCTU
29 PsiBlast_CBE 77.3834% -91 - C1 -3Q7U 7.7 ISPD_MYCTU
18 PsiBlast_PDB 76.2634% -89 - C1 -3Q7U 7.9 ISPD_MYCTU
30 PsiBlast_CBE 76.1134% -91 - C1 -2XWN 8.0 ISPD_MYCTU