@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00910: (2016-06-02 )
MFRIGQGFDVHQLVEGRPLIIGGIEIPYEKGLLGHSDADVLLHTVADACLGAVGEGDIGKHFPDTDPEFKDADSFKLLQHVWGIVKQKGYVLGNIDCTIIAQKPKMLPYIEDMRKRIAEGLEADVSQVNVKATTTEKLGFTGRAEGIAAQATVLIQKG

Atome Classification :

(89 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CTP_B_6(3IEW)
ISPF_BURPS
[Raw transfer]




SUD_D_4(1U43)
ISPF_ECOLI
[Raw transfer]




1AA_C_15(2AMT)
ISPF_ECOLI
[Raw transfer]




1AA_C_14(2AMT)
ISPF_ECOLI
[Raw transfer]




GOL_C_9(3GHZ)
ISPF_SALTY
[Raw transfer]




C5P_B_8(3F0G)
ISPF_BURP1
[Raw transfer]




CDP_C_9(3IEW)
ISPF_BURPS
[Raw transfer]




GOL_A_4(3GHZ)
ISPF_SALTY
[Raw transfer]




CDP_A_5(3IEW)
ISPF_BURPS
[Raw transfer]




AO9_A_9(3Q8H)
ISPF_BURPS
[Raw transfer]




C_A_3(1W55)
ISPDF_CAMJE
[Raw transfer]




C5P_A_3(1JY8)
ISPF_ECOLI
[Raw transfer]




C_B_8(3IEQ)
ISPF_BURP1
[Raw transfer]




1AA_E_18(2AMT)
ISPF_ECOLI
[Raw transfer]




C5P_E_14(3F0G)
ISPF_BURP1
[Raw transfer]




C5P_C_14(5B8F)
ISPF_PSEAE
[Raw transfer]




CTN_C_24(3T80)
ISPF_SALTY
[Raw transfer]




CDP_A_4(1YQN)
ISPF_ECOLI
[Raw transfer]




C5P_C_14(5B8F)
ISPF_PSEAE
[Raw transfer]




CDP_C_15(2UZH)
?
[Raw transfer]




CTN_B_9(3P0Z)
ISPF_BURP1
[Raw transfer]




C5P_A_5(4C8G)
ISPF_BURCJ
[Raw transfer]




C5P_C_10(3F0G)
ISPF_BURP1
[Raw transfer]




CTN_C_13(3QHD)
ISPF_BURP1
[Raw transfer]




CTN_A_6(3P10)
ISPF_BURP1
[Raw transfer]




C5P_A_5(5B8F)
ISPF_PSEAE
[Raw transfer]




CTN_C_12(3P0Z)
ISPF_BURP1
[Raw transfer]




C5P_C_11(4C8G)
ISPF_BURCJ
[Raw transfer]




C5P_B_8(4C8E)
ISPF_BURCJ
[Raw transfer]




C5P_F_16(3F0G)
ISPF_BURP1
[Raw transfer]




I5A_C_11(3K2X)
ISPF_BURP1
[Raw transfer]




C5P_C_8(3F0F)
ISPF_BURP1
[Raw transfer]




1AA_D_19(2AMT)
ISPF_ECOLI
[Raw transfer]




AO9_B_11(3Q8H)
ISPF_BURPS
[Raw transfer]




C5P_B_7(4C8G)
ISPF_BURCJ
[Raw transfer]




C_A_4(3IEQ)
ISPF_BURP1
[Raw transfer]




829_C_10(3KE1)
ISPF_BURP1
[Raw transfer]




CTN_A_6(3QHD)
ISPF_BURP1
[Raw transfer]




CTN_A_7(3P0Z)
ISPF_BURP1
[Raw transfer]




I5A_A_5(3K2X)
ISPF_BURP1
[Raw transfer]




829_A_5(3KE1)
ISPF_BURP1
[Raw transfer]




CTN_B_17(3T80)
ISPF_SALTY
[Raw transfer]




I5A_B_9(3K2X)
ISPF_BURP1
[Raw transfer]




AO9_A_5(3Q8H)
ISPF_BURPS
[Raw transfer]




C5P_C_13(4C8E)
ISPF_BURCJ
[Raw transfer]




CTN_B_11(3QHD)
ISPF_BURP1
[Raw transfer]




829_B_8(3KE1)
ISPF_BURP1
[Raw transfer]




CTN_C_12(3P10)
ISPF_BURP1
[Raw transfer]




CTN_B_9(3P10)
ISPF_BURP1
[Raw transfer]




F01_B_7(3ELC)
ISPF_ECOLI
[Raw transfer]




C_C_10(3IEQ)
ISPF_BURP1
[Raw transfer]




C5P_B_8(4C8E)
ISPF_BURCJ
[Raw transfer]




CAR_E_16(3ERN)
ISPF_ECOLI
[Raw transfer]




CAR_A_8(3ERN)
ISPF_ECOLI
[Raw transfer]




CDP_A_4(4C81)
ISPF_PLAF7
[Raw transfer]




C5P_A_5(2PMP)
ISPF_ARATH
[Raw transfer]




C5P_D_12(3F0G)
ISPF_BURP1
[Raw transfer]




GOL_A_4(3F0F)
ISPF_BURP1
[Raw transfer]




1AA_E_17(2AMT)
ISPF_ECOLI
[Raw transfer]




C5P_C_14(4C8E)
ISPF_BURCJ
[Raw transfer]




1AA_A_13(2AMT)
ISPF_ECOLI
[Raw transfer]




CAR_D_15(3ERN)
ISPF_ECOLI
[Raw transfer]




CAR_B_9(3ERN)
ISPF_ECOLI
[Raw transfer]




F01_A_5(3ELC)
ISPF_ECOLI
[Raw transfer]




F01_C_9(3ELC)
ISPF_ECOLI
[Raw transfer]




CTN_A_10(3T80)
ISPF_SALTY
[Raw transfer]




CAR_C_13(3ERN)
ISPF_ECOLI
[Raw transfer]




C5P_B_8(5B8F)
ISPF_PSEAE
[Raw transfer]




CIT_B_6(4C8I)
ISPF_BURCJ
[Raw transfer]




CIT_C_8(4C8I)
ISPF_BURCJ
[Raw transfer]




535_B_9(3K14)
ISPF_BURP1
[Raw transfer]




535_A_5(3K14)
ISPF_BURP1
[Raw transfer]




CIT_A_4(4C8I)
ISPF_BURCJ
[Raw transfer]




535_C_11(3K14)
ISPF_BURP1
[Raw transfer]




717_A_6(3MBM)
ISPF_BURP1
[Raw transfer]




717_C_11(3MBM)
ISPF_BURP1
[Raw transfer]




717_B_10(3IKF)
ISPF_BURPS
[Raw transfer]




HHV_C_10(3JVH)
ISPF_BURP1
[Raw transfer]




717_A_5(3IKF)
ISPF_BURPS
[Raw transfer]




717_B_10(3MBM)
ISPF_BURP1
[Raw transfer]




HHV_B_8(3JVH)
ISPF_BURP1
[Raw transfer]




717_A_6(3IKF)
ISPF_BURPS
[Raw transfer]




102 HHSearch 96.3862%-116 - C10 -1T0A - ISPF_SHEON -
5 PsiBlast_PDB 96.1961%-125 - C10 -3F0G 3.4 ISPF_BURP1
3 PsiBlast_PDB 96.0961%-127 - C10 -3F0E - ISPF_BURP1 -
79 PsiBlast_CBE 95.9563%-117 - C10 -3T80 2.9 ISPF_SALTY
6 PsiBlast_PDB 95.9361%-128 - C10 -3IEQ 3.5 ISPF_BURP1
84 PsiBlast_CBE 95.8763%-118 - C10 -3ESJ - ISPF_ECOLI -
8 PsiBlast_PDB 95.8661%-124 - C10 -3JVH - ISPF_BURP1 -
80 PsiBlast_CBE 95.8563%-116 - C10 -3GHZ 2.3 ISPF_SALTY
9 PsiBlast_PDB 95.7961%-127 - C10 -3K14 1.8 ISPF_BURP1
4 PsiBlast_PDB 95.6061%-123 - C10 -3F0F 2.1 ISPF_BURP1
1 PsiBlast_PDB 95.5961%-116 - C10 -1T0A - ISPF_SHEON -
16 PsiBlast_PDB 95.5561%-125 - C10 -3QHD 3.5 ISPF_BURP1
17 PsiBlast_PDB 95.5361%-124 - C10 -3IKE - ISPF_BURPS -
14 PsiBlast_PDB 95.4361%-125 - C10 -3P10 3.3 ISPF_BURP1
90 PsiBlast_CBE 95.3963%-116 - C10 -3ERN 2.6 ISPF_ECOLI
124 Fugue 95.3863%-122 * C10 *1JY8 3.2 ISPF_ECOLI
13 PsiBlast_PDB 95.3861%-125 - C10 -3P0Z 3.3 ISPF_BURP1
54 PsiBlast_CBE 95.2561%-122 - C10 -3F0D - ISPF_BURP1 -
7 PsiBlast_PDB 95.2561%-127 - C10 -3IEW 3.0 ISPF_BURPS
45 PsiBlast_CBE 95.2361%-123 - C10 -3F0G 3.4 ISPF_BURP1
18 PsiBlast_PDB 95.2261%-127 - C10 -3IKF 3.3 ISPF_BURPS
100 PsiBlast_CBE 94.9863%-116 - C10 -2AMT 3.5 ISPF_ECOLI
21 PsiBlast_CBE 94.9761%-126 - C10 -3QHD 3.4 ISPF_BURP1
87 PsiBlast_CBE 94.9563%-116 - C10 -3ERN 2.8 ISPF_ECOLI
92 PsiBlast_CBE 94.9463%-120 - C10 -3ELC 3.1 ISPF_ECOLI
98 PsiBlast_CBE 94.9363%-114 - C10 -2AMT 4.0 ISPF_ECOLI
82 PsiBlast_CBE 94.9363%-115 - C10 -3GHZ 3.3 ISPF_SALTY
12 PsiBlast_PDB 94.9361%-123 - C10 -3MBM 3.2 ISPF_BURP1
99 PsiBlast_CBE 94.6063%-116 - C10 -2AMT 3.4 ISPF_ECOLI
101 PsiBlast_CBE 94.5463%-113 - C10 -1U43 2.8 ISPF_ECOLI
93 PsiBlast_CBE 94.5063%-120 - C10 -3ELC 3.1 ISPF_ECOLI
66 PsiBlast_CBE 94.5061%-120 - C10 -4C8I 3.0 ISPF_BURCJ
95 PsiBlast_CBE 94.4763%-115 - C10 -2AMT 4.0 ISPF_ECOLI
49 PsiBlast_CBE 94.3961%-126 - C10 -3F0F 3.2 ISPF_BURP1
89 PsiBlast_CBE 94.3663%-117 - C10 -3ERN 2.6 ISPF_ECOLI
23 PsiBlast_CBE 94.3561%-126 - C10 -3Q8H 3.7 ISPF_BURPS
10 PsiBlast_PDB 94.3261%-127 - C10 -3K2X 4.0 ISPF_BURP1
26 PsiBlast_CBE 94.2261%-127 - C10 -3P10 3.6 ISPF_BURP1
94 PsiBlast_CBE 94.0763%-119 - C10 -3ELC 3.1 ISPF_ECOLI
96 PsiBlast_CBE 93.9263%-115 - C10 -2AMT 4.2 ISPF_ECOLI
37 PsiBlast_CBE 93.8361%-127 - C10 -3JVH 3.1 ISPF_BURP1
108 HHSearch 93.7960%-126 - C10 -4C8E 3.2 ISPF_BURCJ
34 PsiBlast_CBE 93.7061%-129 - C10 -3K2X 3.8 ISPF_BURP1
106 HHSearch 93.5861%-119 - C10 -5B8F 3.3 ISPF_PSEAE
47 PsiBlast_CBE 93.5661%-126 - C10 -3F0G 3.1 ISPF_BURP1
24 PsiBlast_CBE 93.4361%-126 - C10 -3Q8H 3.4 ISPF_BURPS
20 PsiBlast_PDB 93.3261%-120 - C10 -5B8F 3.3 ISPF_PSEAE
63 PsiBlast_CBE 93.0961%-124 - C10 -5B8F 2.9 ISPF_PSEAE
97 PsiBlast_CBE 93.0563%-110 - C10 -2AMT 4.0 ISPF_ECOLI
40 PsiBlast_CBE 93.0161%-134 - C10 -3IEW 3.8 ISPF_BURPS
103 HHSearch 92.9961%-117 - C10 -1YQN 3.5 ISPF_ECOLI
27 PsiBlast_CBE 92.9961%-128 - C10 -3P0Z 3.3 ISPF_BURP1
25 PsiBlast_CBE 92.9261%-127 - C10 -3P10 3.2 ISPF_BURP1
64 PsiBlast_CBE 92.9161%-120 - C10 -5B8F 3.2 ISPF_PSEAE
33 PsiBlast_CBE 92.8461%-134 - C10 -3K2X 3.3 ISPF_BURP1
42 PsiBlast_CBE 92.8161%-128 - C10 -3IEQ 3.4 ISPF_BURP1
73 PsiBlast_CBE 92.7661%-125 - C10 -4C8E 3.2 ISPF_BURCJ
58 PsiBlast_CBE 92.6661%-135 - C10 -3IKF 3.3 ISPF_BURPS
71 PsiBlast_CBE 92.6261%-123 - C10 -4C8E 3.9 ISPF_BURCJ
30 PsiBlast_CBE 92.5661%-128 - C10 -3MBM 2.9 ISPF_BURP1
15 PsiBlast_PDB 92.4861%-129 - C10 -3Q8H 3.4 ISPF_BURPS
28 PsiBlast_CBE 92.4061%-128 - C10 -3P0Z 3.6 ISPF_BURP1
29 PsiBlast_CBE 92.3361%-122 - C10 -3MBM 3.2 ISPF_BURP1
35 PsiBlast_CBE 92.2561%-127 - C10 -3K14 2.7 ISPF_BURP1
88 PsiBlast_CBE 92.2163%-122 - C10 -3ERN 3.1 ISPF_ECOLI
11 PsiBlast_PDB 92.1061%-130 - C10 -3KE1 3.2 ISPF_BURP1
77 PsiBlast_CBE 92.0863%-118 - C10 -3T80 3.1 ISPF_SALTY
72 PsiBlast_CBE 92.0861%-121 - C10 -4C8E 3.3 ISPF_BURCJ
32 PsiBlast_CBE 92.0661%-129 - C10 -3KE1 3.1 ISPF_BURP1
31 PsiBlast_CBE 91.9661%-127 - C10 -3KE1 2.8 ISPF_BURP1
39 PsiBlast_CBE 91.8161%-126 - C10 -3IEW 3.1 ISPF_BURPS
36 PsiBlast_CBE 91.8061%-134 - C10 -3K14 3.1 ISPF_BURP1
85 PsiBlast_CBE 91.6463%-125 - C10 -3ERN 3.0 ISPF_ECOLI
65 PsiBlast_CBE 91.3761%-121 - C10 -4C8I 4.2 ISPF_BURCJ
57 PsiBlast_CBE 91.2461%-127 - C10 -3IKF 2.4 ISPF_BURPS
22 PsiBlast_CBE 91.1561%-127 - C10 -3QHD 3.6 ISPF_BURP1
38 PsiBlast_CBE 91.1061%-128 - C10 -3JVH 3.1 ISPF_BURP1
69 PsiBlast_CBE 91.0261%-129 - C10 -4C8G 3.4 ISPF_BURCJ
41 PsiBlast_CBE 90.9761%-127 - C10 -3IEQ 3.2 ISPF_BURP1
67 PsiBlast_CBE 90.7461%-121 - C10 -4C8I 3.6 ISPF_BURCJ
44 PsiBlast_CBE 90.6361%-125 - C10 -3F0G 3.1 ISPF_BURP1
43 PsiBlast_CBE 90.5261%-129 - C10 -3F0G 2.7 ISPF_BURP1
70 PsiBlast_CBE 90.1561%-127 - C10 -4C8G 3.1 ISPF_BURCJ
68 PsiBlast_CBE 89.7861%-122 - C10 -4C8G 3.2 ISPF_BURCJ
78 PsiBlast_CBE 89.4063%-113 - C10 -3T80 3.1 ISPF_SALTY
113 HHSearch 87.5747%-117 - C10 -1W55 3.5 ISPDF_CAMJE
104 HHSearch 86.8248%-118 - C10 -2PMP 3.4 ISPF_ARATH
109 HHSearch 81.1540%-123 - C10 -2UZH 3.4 ?
112 HHSearch 79.2238%-122 - C10 -4C81 3.3 ISPF_PLAF7