@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00930: (2016-06-02 )
MFFRMLKEDIDTVFDQDPAARSYFEVILTYSGLHAIWAHRIAHALYKRKFYFLARLISQVSRFFTGIEIHPGATIGRRFFIDHGMGVVIGETCEIGNNVTVFQGVTLGGTGKEKGKRHPTIKDDALIATGAKVLGSITVGEGSKIGAGSVVLHDVPDFSTVVGIPGRVVVQNGKKVRRDLNHQDLPDPVADRFKSLEQQILELKAELEDRKERINQK

Atome Classification :

(30 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CYS_B_4(1T3D)
CYSE_ECOLI
[Raw transfer]




CYS_B_8(4H7O)
?
[Raw transfer]




CYS_A_6(4H7O)
?
[Raw transfer]




SER_B_5(4N69)
?
[Raw transfer]




SER_A_2(3Q1X)
?
[Raw transfer]




CYS_A_2(3P47)
?
[Raw transfer]




SER_A_2(3Q1X)
?
[Raw transfer]




COA_I_9(1SST)
CYSE_HAEIN
[Raw transfer]




COA_G_7(1SST)
CYSE_HAEIN
[Raw transfer]




COA_G_7(1SST)
CYSE_HAEIN
[Raw transfer]




COA_K_11(1SST)
CYSE_HAEIN
[Raw transfer]




COA_A_3(4HZD)
?
[Raw transfer]




COA_A_3(4HZD)
?
[Raw transfer]




COA_I_9(1SST)
CYSE_HAEIN
[Raw transfer]




CYS_A_6(4H7O)
?
[Raw transfer]




CYS_A_5(1SSQ)
CYSE_HAEIN
[Raw transfer]




CYS_A_6(4H7O)
?
[Raw transfer]




CYS_A_5(1SSQ)
CYSE_HAEIN
[Raw transfer]




CYS_B_8(4H7O)
?
[Raw transfer]




CYS_A_5(1SSQ)
CYSE_HAEIN
[Raw transfer]




CYS_A_5(1SSQ)
CYSE_HAEIN
[Raw transfer]




136 Fugue 92.2542%-124 - C2 -1SSQ 3.5 CYSE_HAEIN
40 PsiBlast_CBE 86.4650%-133 - C2 -3GVD - ? -
49 PsiBlast_CBE 85.0850%-136 - C2 -3GVD - ? -
50 PsiBlast_CBE 84.0450%-127 - C2 -3GVD - ? -
2 PsiBlast_PDB 83.9846%-124 - C2 -4HZC - ? -
1 PsiBlast_PDB 83.9446%-125 - C2 -4HZD 4.4 ?
46 PsiBlast_CBE 83.8050%-130 - C2 -3GVD - ? -
12 PsiBlast_PDB 83.7548%-132 - C2 -1T3D 3.5 CYSE_ECOLI
6 PsiBlast_PDB 83.7050%-132 - C2 -3GVD - ? -
48 PsiBlast_CBE 83.3950%-128 - C2 -3GVD - ? -
42 PsiBlast_CBE 83.2050%-132 - C2 -3GVD - ? -
54 PsiBlast_CBE 83.1945%-124 - C2 -4H7O 2.7 ?
41 PsiBlast_CBE 83.1750%-127 - C2 -3GVD - ? -
47 PsiBlast_CBE 83.1450%-132 - C2 -3GVD - ? -
7 PsiBlast_PDB 82.9145%-129 - C2 -1SSQ 3.5 CYSE_HAEIN
28 PsiBlast_CBE 82.8146%-123 - C2 -4HZC - ? -
21 PsiBlast_CBE 82.3146%-122 - C2 -4HZD - ? -
51 PsiBlast_CBE 82.2145%-139 - C2 -1SST 5.1 CYSE_HAEIN
120 HHSearch 81.9842%-120 - C2 -1SSQ 3.5 CYSE_HAEIN
116 HHSearch 81.9245%-115 - C2 -4HZD 4.4 ?
8 PsiBlast_PDB 81.8445%-144 - C2 -1SST 5.8 CYSE_HAEIN
10 PsiBlast_PDB 81.6845%-123 - C2 -4H7O 3.7 ?
53 PsiBlast_CBE 81.5245%-114 * C2 *1SSQ 3.6 CYSE_HAEIN
119 HHSearch 81.0943%-114 - C2 -4H7O 3.7 ?
55 PsiBlast_CBE 81.0945%-120 - C2 -4H7O 3.6 ?
39 PsiBlast_CBE 80.2148%-133 - C2 -4N69 3.5 ?
117 HHSearch 78.9142%-128 - C2 -3Q1X 2.5 ?
52 PsiBlast_CBE 78.3245%-135 - C2 -1SST 4.8 CYSE_HAEIN
14 PsiBlast_PDB 77.2643%-130 - C2 -3Q1X 2.4 ?
15 PsiBlast_PDB 76.9843%-128 - C2 -3P47 2.8 ?