@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu01020: (2016-06-02 )
MAKKVVKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEISVYEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATVKRDKVREIAETKMPDLNAADVEAAMRMVEGTARSMGIVIED

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SAH_A_9(3CJQ)
RL11_THETH
[Raw transfer]




SAH_D_11(3CJQ)
RL11_THETH
[Raw transfer]




2MM_H_14(3CJQ)
RL11_THETH
[Raw transfer]




EDO_B_4(3CJS)
RL11_THETH
[Raw transfer]




EDO_B_4(3CJS)
RL11_THETH
[Raw transfer]




4MM_B_9(3EGV)
RL11_THET8
[Raw transfer]




4MM_B_9(3EGV)
RL11_THET8
[Raw transfer]




2 PsiBlast_PDB 91.6770%-136 - C2 -2JQ7 - RL11_THEMA -
3 PsiBlast_PDB 91.0070%-119 - C2 -2K3F - RL11_THEMA -
19 PsiBlast_PDB 89.9767%-117 - C2 -5GAD - RL11_ECOLI -
13 PsiBlast_PDB 89.2572%-123 - C2 -487D - RL11_ECOLI -
34 HHSearch 89.0470%-118 - C2 -1MMS - RL11_THEMA -
7 PsiBlast_PDB 89.0470%-118 - C2 -1OLN - RL11_THEMA -
5 PsiBlast_PDB 89.0470%-118 - C2 -1MMS - RL11_THEMA -
46 Fugue 88.7669%-118 - C2 -1MMS - RL11_THEMA -
17 PsiBlast_PDB 88.3367%-122 - C2 -3J8G - RL11_ECOLI -
24 PsiBlast_CBE 87.0964%-134 - C2 -3CJT - RL11_THETH -
25 PsiBlast_CBE 85.9664%-121 - C2 -3CJT - RL11_THETH -
26 PsiBlast_CBE 84.9464%-129 - C2 -3CJT - RL11_THETH -
18 PsiBlast_PDB 81.9367%-109 - C2 -5ADY - RL11_ECOLI -
21 PsiBlast_CBE 80.8766%-108 - C2 -3CF5 - RL11_DEIRA -
27 PsiBlast_CBE 80.1663%-133 - C2 -3CJQ Error RL11_THETH
29 PsiBlast_CBE 78.5863%-131 - C2 -3CJQ Error RL11_THETH
16 PsiBlast_PDB 74.7567% -83 - C2 -3J7Z - RL11_ECOLI -
28 PsiBlast_CBE 74.4763%-129 - C2 -3CJQ Error RL11_THETH
41 HHSearch 70.9472%-144 - C2 -3CJS 3.1 RL11_THETH
31 PsiBlast_CBE 70.3173%-144 - C2 -3CJS 3.0 RL11_THETH
30 PsiBlast_CBE 67.7663%-142 - C2 -3EGV 2.8 RL11_THET8
33 HHSearch 67.5962%-142 - C2 -3EGV 2.8 RL11_THET8