@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu01450: (2016-06-03 )
MNQNQLISVEDIVFRYRKDAERRALDGVSLQVYEGEWLAIVGHNGSGKSTLARALNGLILPESGDIEVAGIQLTEESVWEVRKKIGMVFQNPDNQFVGTTVRDDVAFGLENNGVPREEMIERVDWAVKQVNMQDFLDQEPHHLSGGQKQRVAIAGVIAARPDIIILDEATSMLDPIGREEVLETVRHLKEQGMATVISITHDLNEAAKADRIIVMNGGKKYAEGPPEEIFKLNKELVRIGLDLPFSFQLSQLLRENGLALEENHLTQEGLVKELWTLQSKM

Atome Classification :

(61 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_J_5(4YMU)
?
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




ATP_F_6(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_E_5(2FGJ)
HLYBP_ECOLX
[Raw transfer]




ATP_G_7(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_A_5(1B0U)
HISP_SALTY
[Raw transfer]




ATP_E_5(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_J_5(4YMV)
?
[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




ATP_H_8(2FGK)

[Raw transfer]




ATP_A_6(4YMV)
?
[Raw transfer]




ANP_A_6(4ZIR)
ECFA2_THEMA
[Raw transfer]




ATP_C_11(1XEF)
HLYBP_ECOLX
[Raw transfer]




ATP_H_8(2FGJ)

[Raw transfer]




ATP_B_10(1XEF)
HLYBP_ECOLX
[Raw transfer]




128_A_2(2PMK)

[Raw transfer]




ATP_D_12(1XEF)

[Raw transfer]




12D_A_2(3B5J)

[Raw transfer]




ANP_K_6(3C41)
?
[Raw transfer]




AGS_B_6(3C4J)
?
[Raw transfer]




ATP_G_7(2FGJ)
HLYBP_ECOLX
[Raw transfer]




ATP_A_9(1XEF)
HLYBP_ECOLX
[Raw transfer]




ATP_F_6(2FGJ)
HLYBP_ECOLX
[Raw transfer]




ADP_B_9(4HLU)
ECFA2_THEMA
[Raw transfer]




ADP_C_11(4HLU)
ECFA1_THEMA
[Raw transfer]




ADP_B_2(2FF7)

[Raw transfer]




ADP_B_2(2FFA)

[Raw transfer]




ADP_B_2(2FFB)

[Raw transfer]




ADP_B_6(2Q0H)
?
[Raw transfer]




ADP_A_5(2Q0H)
?
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




AGS_A_3(4S0F)
?
[Raw transfer]




ADP_A_5(4HLU)
ECFA2_THEMA
[Raw transfer]




ADP_A_2(4U00)
?
[Raw transfer]




ADP_B_6(2OLJ)
?
[Raw transfer]




ATP_C_3(1VCI)
?
[Raw transfer]




AT4_A_5(2OLK)
?
[Raw transfer]




AGS_B_4(4S0F)
?
[Raw transfer]




AT4_B_6(2OLK)
?
[Raw transfer]




AT4_D_8(2OLK)
?
[Raw transfer]




AT4_C_7(2OLK)
?
[Raw transfer]




LMT_B_4(4MKI)
ECFA2_CALS4
[Raw transfer]




LMT_A_7(4MKI)
ECFA2_CALS4
[Raw transfer]




1 PsiBlast_PDB 97.3053% -92 - C1 -5D3M - ? -
123 HHSearch 94.6453% -86 - C1 -4HUQ - ECFA1_LACBA -
2 PsiBlast_PDB 94.2853% -82 - C1 -4HUQ - ECFA1_LACBA -
3 PsiBlast_PDB 90.5053% -77 - C1 -4HZU - ECFA1_LACBA -
122 HHSearch 84.9540% -89 - C1 -4MKI 2.6 ECFA2_CALS4
121 HHSearch 82.3438% -89 - C1 -4HUQ - ECFA2_LACBA -
21 PsiBlast_CBE 81.9640% -91 - C1 -4MKI 2.6 ECFA2_CALS4
4 PsiBlast_PDB 81.8340% -89 - C1 -4MKI - ECFA2_CALS4 -
117 Fugue 77.4130% -90 - C1 -3TUZ - METN_ECOLI -
18 PsiBlast_PDB 74.0234% -87 - C1 -3TUI - METN_ECOLI -
32 PsiBlast_CBE 73.6234% -88 - C1 -3TUI - METN_ECOLI -
30 PsiBlast_CBE 73.2934% -90 - C1 -3TUZ - METN_ECOLI -
19 PsiBlast_PDB 73.1134% -90 - C1 -3TUZ - METN_ECOLI -
33 PsiBlast_CBE 73.0934% -86 - C1 -3TUI - METN_ECOLI -
139 HHSearch 72.4338% -94 - C1 -3GFO - ECFA3_CLOP1 -
34 PsiBlast_CBE 72.1534% -84 - C1 -3TUI - METN_ECOLI -
5 PsiBlast_PDB 72.0735% -92 - C1 -3GFO - ECFA3_CLOP1 -
29 PsiBlast_CBE 71.9434% -88 - C1 -3TUZ - METN_ECOLI -
11 PsiBlast_PDB 71.0440% -85 - C1 -4U02 - ? -
10 PsiBlast_PDB 70.9640% -87 - C1 -4U00 4.2 ?
118 Fugue 70.9535% -87 - C1 -1B0U 5.4 HISP_SALTY
48 PsiBlast_CBE 69.6237% -94 - C1 -2OLK 4.2 ?
49 PsiBlast_CBE 69.3937% -91 - C1 -2OLK 4.0 ?
50 PsiBlast_CBE 68.8237% -92 - C1 -2OLK 3.9 ?
15 PsiBlast_PDB 68.6437% -89 - C1 -4YMV 3.8 ?
38 PsiBlast_CBE 68.1937% -91 - C1 -3C41 4.8 ?
47 PsiBlast_CBE 68.0737% -90 - C1 -2OLK 4.0 ?
28 PsiBlast_CBE 68.0637% -94 - C1 -4YMU 4.7 ?
42 PsiBlast_CBE 67.6137% -89 - C1 -2Q0H 3.3 ?
52 PsiBlast_CBE 67.5337% -89 - C1 -2OLJ 3.9 ?
39 PsiBlast_CBE 67.0337% -89 - C1 -3C4J 3.2 ?
14 PsiBlast_PDB 66.9837% -92 - C1 -4YMU 5.5 ?
27 PsiBlast_CBE 66.8237% -90 - C1 -4YMV 4.3 ?
37 PsiBlast_CBE 66.6237% -89 - C1 -3C41 3.6 ?
40 PsiBlast_CBE 66.5737% -84 - C1 -3C4J 4.4 ?
7 PsiBlast_PDB 65.8838% -67 - C1 -4HLU 5.4 ECFA2_THEMA
36 PsiBlast_CBE 65.7135% -90 - C1 -4HLU 5.7 ECFA1_THEMA
41 PsiBlast_CBE 65.5937% -89 - C1 -2Q0H 3.8 ?
22 PsiBlast_CBE 64.9638% -66 - C1 -4HLU 5.9 ECFA2_THEMA
51 PsiBlast_CBE 64.4137% -87 - C1 -2OLJ 3.5 ?
57 PsiBlast_CBE 64.2535% -89 - C1 -2FF7 6.5
55 PsiBlast_CBE 64.1535% -80 - C1 -4S0F 3.6 ?
59 PsiBlast_CBE 64.0335% -92 - C1 -2PMK 7.2
56 PsiBlast_CBE 64.0035% -77 - C1 -4S0F 3.8 ?
95 PsiBlast_CBE 62.6934% -80 - C1 -2FGJ 7.5 HLYBP_ECOLX
54 PsiBlast_CBE 62.5934% -85 - C1 -1VCI 3.0 ?
97 PsiBlast_CBE 62.2334% -90 - C1 -2FFA 6.5
64 PsiBlast_CBE 61.9634% -85 - C1 -2FFB 6.5
6 PsiBlast_PDB 61.7538% -69 - C1 -4ZIR 5.5 ECFA2_THEMA
65 PsiBlast_CBE 61.6835% -86 - C1 -3B5J 7.0
98 PsiBlast_CBE 61.6534% -84 - C1 -1XEF 7.1
100 PsiBlast_CBE 61.4634% -79 - C1 -1XEF 7.1 HLYBP_ECOLX
94 PsiBlast_CBE 61.3434% -80 - C1 -2FGJ 7.0 HLYBP_ECOLX
60 PsiBlast_CBE 61.2534% -87 - C1 -2FGK 7.5
62 PsiBlast_CBE 60.9134% -85 - C1 -2FGK 7.3 HLYBP_ECOLX
101 PsiBlast_CBE 60.6534% -82 - C1 -1XEF 5.9 HLYBP_ECOLX
93 PsiBlast_CBE 60.6334% -81 - C1 -2FGJ 7.0
96 PsiBlast_CBE 60.2034% -76 - C1 -2FGJ 7.1 HLYBP_ECOLX
99 PsiBlast_CBE 59.8534% -83 - C1 -1XEF 6.8 HLYBP_ECOLX
61 PsiBlast_CBE 59.8434% -82 - C1 -2FGK 6.2 HLYBP_ECOLX
63 PsiBlast_CBE 59.1434% -81 - C1 -2FGK 6.9 HLYBP_ECOLX