@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu01460: (2016-06-03 )
MKTPFERLALYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISLGSTVIQAGKKNKDLKKLRKKVGIVFQFPEHQLFEETVLKDISFGPMNFGVKKEDAEQKAREMLQLVGLSEELLDRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMFYELHQRGNLTTILVTHSMEDAAAYADEMIVMHKGTIQASGSPRDLFLKGEEMAGWGLDLPETIKFQRHLEAALGVRFNEPMLTIEDAAAEIRALFQGEKTL

Atome Classification :

(48 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_5(1L2T)
Y796_METJA
[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




ATP_J_5(4YMV)
?
[Raw transfer]




ATP_J_5(4YMU)
?
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




ATP_B_6(1L2T)
Y796_METJA
[Raw transfer]




ATP_B_3(4FWI)
?
[Raw transfer]




ANP_K_6(3C41)
?
[Raw transfer]




ATP_A_6(4YMV)
?
[Raw transfer]




AGS_B_6(3C4J)
?
[Raw transfer]




ATP_A_3(3FVQ)
FBPC_NEIG1
[Raw transfer]




ATP_A_3(3FVQ)
FBPC_NEIG1
[Raw transfer]




ATP_B_6(3FVQ)
FBPC_NEIG1
[Raw transfer]




ADP_A_3(3TIF)
Y796_METJA
[Raw transfer]




ADP_C_11(4HLU)
ECFA1_THEMA
[Raw transfer]




ADP_B_6(2Q0H)
?
[Raw transfer]




ADP_B_9(4HLU)
ECFA2_THEMA
[Raw transfer]




ADP_A_5(2Q0H)
?
[Raw transfer]




ANP_A_6(4ZIR)
ECFA2_THEMA
[Raw transfer]




ADP_D_7(4HLU)
ECFA1_THEMA
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




ADP_A_5(4HLU)
ECFA2_THEMA
[Raw transfer]




ADP_B_10(1G9X)
LIVG_METJA
[Raw transfer]




ADP_A_2(4U00)
?
[Raw transfer]




ADP_B_8(3TIF)
Y796_METJA
[Raw transfer]




ADP_B_6(2OLJ)
?
[Raw transfer]




AT4_B_6(2OLK)
?
[Raw transfer]




ADP_A_4(1G6H)
LIVG_METJA
[Raw transfer]




AT4_D_8(2OLK)
?
[Raw transfer]




ADP_A_8(1G9X)
LIVG_METJA
[Raw transfer]




ATP_C_3(1VCI)
?
[Raw transfer]




ADP_C_12(1G9X)
LIVG_METJA
[Raw transfer]




AT4_C_7(2OLK)
?
[Raw transfer]




AT4_A_5(2OLK)
?
[Raw transfer]




LMT_B_4(4MKI)
ECFA2_CALS4
[Raw transfer]




ATP_A_5(1B0U)
HISP_SALTY
[Raw transfer]




LMT_A_7(4MKI)
ECFA2_CALS4
[Raw transfer]




1 PsiBlast_PDB 93.3151% -98 - C1 -4MKI - ECFA2_CALS4 -
21 PsiBlast_CBE 92.9251%-101 - C1 -4MKI 2.5 ECFA2_CALS4
104 HHSearch 92.7953%-100 - C1 -4HUQ - ECFA2_LACBA -
105 HHSearch 92.7552% -96 - C1 -4MKI 2.7 ECFA2_CALS4
2 PsiBlast_PDB 91.6554% -99 - C1 -4HUQ - ECFA2_LACBA -
3 PsiBlast_PDB 87.9554% -92 - C1 -4HZU - ECFA2_LACBA -
4 PsiBlast_PDB 87.2947% -93 - C1 -5D3M - ? -
121 HHSearch 74.1340%-106 - C1 -3GFO - ECFA3_CLOP1 -
5 PsiBlast_PDB 73.8340%-105 - C1 -3GFO - ECFA3_CLOP1 -
16 PsiBlast_PDB 71.1541%-105 - C1 -2OLJ 4.0 ?
33 PsiBlast_CBE 70.8041%-105 - C1 -2OLK 4.3 ?
34 PsiBlast_CBE 69.5241%-105 - C1 -2OLK 4.1 ?
17 PsiBlast_PDB 69.4741%-102 - C1 -2OLK 3.9 ?
27 PsiBlast_CBE 69.4641%-106 - C1 -3C4J 4.1 ?
32 PsiBlast_CBE 69.4541%-105 - C1 -2OLK 4.0 ?
26 PsiBlast_CBE 69.3941%-103 - C1 -3C41 3.6 ?
29 PsiBlast_CBE 69.0641%-100 - C1 -2OUK - ? -
18 PsiBlast_PDB 69.0441%-104 - C1 -2OUK - ? -
31 PsiBlast_CBE 68.6141%-103 - C1 -2OUK - ? -
24 PsiBlast_CBE 68.5139% -97 - C1 -4YMU 4.1 ?
20 PsiBlast_PDB 68.5041%-102 - C1 -3C4J 4.7 ?
15 PsiBlast_PDB 68.3341% -99 - C1 -3C41 4.8 ?
23 PsiBlast_CBE 67.9939% -98 - C1 -4YMV 3.5 ?
9 PsiBlast_PDB 67.9339% -95 - C1 -4YMU 4.6 ?
19 PsiBlast_PDB 67.8441%-101 - C1 -2Q0H 3.3 ?
28 PsiBlast_CBE 67.7941%-103 - C1 -2Q0H 3.9 ?
10 PsiBlast_PDB 66.7639% -94 - C1 -4YMV 4.8 ?
35 PsiBlast_CBE 66.5341% -99 - C1 -2OLJ 3.6 ?
72 PsiBlast_CBE 66.4436% -90 - C1 -3FVQ 5.0 FBPC_NEIG1
73 PsiBlast_CBE 65.7436% -90 - C1 -3FVQ 4.4 FBPC_NEIG1
102 PsiBlast_CBE 65.4034%-115 - C1 -1G6H 4.5 LIVG_METJA
40 PsiBlast_CBE 64.4636% -93 - C1 -4U00 4.3 ?
95 PsiBlast_CBE 64.0434%-113 - C1 -1G9X 4.4 LIVG_METJA
77 PsiBlast_CBE 63.8133%-112 - C1 -3TIF 4.7 Y796_METJA
78 PsiBlast_CBE 63.3933%-106 - C1 -3TIF 4.4 Y796_METJA
96 PsiBlast_CBE 63.3434%-111 - C1 -1G9X 3.2 LIVG_METJA
94 PsiBlast_CBE 63.0234%-110 - C1 -1G9X 2.8 LIVG_METJA
75 PsiBlast_CBE 62.5533%-107 - C1 -1L2T 4.2 Y796_METJA
74 PsiBlast_CBE 62.5333%-108 - C1 -1L2T 4.4 Y796_METJA
110 HHSearch 61.4435% -91 - C1 -3FVQ 5.0 FBPC_NEIG1
14 PsiBlast_PDB 60.8338% -93 - C1 -4HLU 4.4 ECFA2_THEMA
25 PsiBlast_CBE 60.6138% -93 - C1 -4HLU 4.7 ECFA2_THEMA
13 PsiBlast_PDB 60.5238% -97 - C1 -4ZIR 5.1 ECFA2_THEMA
68 PsiBlast_CBE 59.7939%-109 - C1 -4HLU 4.1 ECFA1_THEMA
67 PsiBlast_CBE 59.5739%-109 - C1 -4HLU 3.7 ECFA1_THEMA
103 PsiBlast_CBE 58.3833%-110 - C1 -4FWI 6.1 ?
69 PsiBlast_CBE 56.7033%-106 - C1 -1VCI 2.7 ?
88 PsiBlast_CBE 55.0035% -97 - C1 -1B0U 3.3 HISP_SALTY