@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu02090: (2016-06-03 )
MKKWIYVVLVLSIAGIGGFSVHAASSAHEKHLNVSKMNVDDEFKDTDGTFILHDLQKDQTFVYNRKRANQRQTPQSTFKVVNALIGLQVKAVRDEYDVKRWDGVKREFESWNRDHTLGSAMRESAIWYYQALARDIGEERMKTWLHTLSYGNEDISGGIDQFWLQSSLTISPLEQETFLEKLAKEELPFDKPVMKIVKRMMIQEEGDHYTLYGKTGTRLTDMGLGWFVGFIKTEHGSYVFVTNVDDSGTKAKNITVDILKKYGLITS

Atome Classification :

(27 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TLA_B_7(3IF6)
?
[Raw transfer]




CIT_A_2(4K0W)
?
[Raw transfer]




POP_C_9(1XA1)
BLAR_STAAU
[Raw transfer]




POP_B_11(1XA1)
BLAR_STAAU
[Raw transfer]




FLC_A_2(4JF5)
?
[Raw transfer]




GOL_A_5(2IWB)

[Raw transfer]




GOL_A_6(2IWB)

[Raw transfer]




GOL_A_6(2IWB)

[Raw transfer]




FLC_A_3(5CTM)
?
[Raw transfer]




EDO_A_5(5E2F)
YBXI_BACSU
[Raw transfer]




EDO_B_10(3IF6)
?
[Raw transfer]




111 HHSearch 91.10100% -95 - C3 -5E2F 2.3 YBXI_BACSU
1 PsiBlast_PDB 90.2096% -95 - C3 -5E2F - YBXI_BACSU -
114 HHSearch 76.5560% -97 * C3 *5CTM 3.2 ?
22 PsiBlast_CBE 75.6660% -92 - C3 -5CTM - ? -
40 PsiBlast_CBE 74.9540%-123 - C3 -4WMC - ? -
21 PsiBlast_CBE 74.5060% -85 - C3 -5CTN - ? -
3 PsiBlast_PDB 74.5060% -93 - C3 -5CTM - ? -
24 PsiBlast_CBE 74.1741%-116 - C3 -4S2M - ? -
32 PsiBlast_CBE 73.9141%-112 - C3 -4S2J - ? -
31 PsiBlast_CBE 73.3041%-112 - C3 -4S2J - ? -
25 PsiBlast_CBE 72.6741%-112 - C3 -4S2M - ? -
2 PsiBlast_PDB 72.6660% -88 - C3 -5CTN - ? -
36 PsiBlast_CBE 72.5141%-111 - C3 -4WMC - ? -
38 PsiBlast_CBE 72.4041%-118 - C3 -4WMC - ? -
9 PsiBlast_PDB 72.3941%-113 - C3 -5FAT - ? -
30 PsiBlast_CBE 72.2941%-113 - C3 -4S2J - ? -
5 PsiBlast_PDB 72.2241%-110 - C3 -4S2J - ? -
39 PsiBlast_CBE 72.1240%-115 - C3 -4S2L - ? -
23 PsiBlast_CBE 72.1141%-116 - C3 -4S2M - ? -
28 PsiBlast_CBE 72.0341%-108 - C3 -4S2K - ? -
94 PsiBlast_CBE 64.3631% -92 - C3 -1XA1 2.9 BLAR_STAAU
95 PsiBlast_CBE 61.0231% -81 - C3 -1XA1 2.9 BLAR_STAAU
81 PsiBlast_CBE 59.2433% -75 - C3 -2IWB 3.2
112 HHSearch 57.9733% -72 - C3 -2IWB 3.2
124 HHSearch 57.0133% -82 - C3 -4JF5 4.4 ?
98 PsiBlast_CBE 54.7135% -81 - C3 -4K0W 3.7 ?
80 PsiBlast_CBE 52.9739% -81 - C3 -3IF6 3.1 ?