@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu02360: (2016-06-04 )
MKILIAEHYEELCKLSAAIIKEQIQAKKDAVLGLATGSTPVGLYKQLISDYQAGEIDFSKVTTFNLDEYAGLSPSHPQSYNHFMHEHLFQHINMQPDHIHIPQGDNPQLEAACKVYEDLIRQAGGIDVQILGIGANGHIGFNEPGSDFEDRTRVVKLSESTIQANARFFGGDPVLVPRLAISMGIKTIMEFSKHIVLLASGEEKADAIQKMAEGPVTTDVPASILQKHNHVTVIADYKAAQKLKSASFS

Atome Classification :

(34 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AGP_B_16(1HOR)
NAGB_ECOLI
[Raw transfer]




F6R_A_3(2BKX)
NAGB_BACSU
[Raw transfer]




AGP_A_13(1HOR)
NAGB_ECOLI
[Raw transfer]




F6R_B_4(2BKX)
NAGB_BACSU
[Raw transfer]




F6R_A_3(2BKX)
NAGB_BACSU
[Raw transfer]




F6R_A_5(5HJ5)
NAGB_VIBCH
[Raw transfer]




F6R_D_17(5HJ5)
NAGB_VIBCH
[Raw transfer]




F6R_A_5(5HJ5)
NAGB_VIBCH
[Raw transfer]




F6R_C_14(5HJ5)
NAGB_VIBCH
[Raw transfer]




F6R_B_10(5HJ5)
NAGB_VIBCH
[Raw transfer]




FPC_A_10(1FQO)
NAGB_ECOLI
[Raw transfer]




GLP_B_4(2RI1)
NAGB_STRMU
[Raw transfer]




F6R_B_16(1FQO)
NAGB_ECOLI
[Raw transfer]




GLP_A_3(2RI1)
NAGB_STRMU
[Raw transfer]




FGS_A_4(2WU1)
NAGB_ECOLI
[Raw transfer]




FGS_B_6(2WU1)
NAGB_ECOLI
[Raw transfer]




PGA_A_3(2BKV)
NAGB_BACSU
[Raw transfer]




TLA_A_5(1FS5)
NAGB_ECOLI
[Raw transfer]




PGA_B_4(2BKV)
NAGB_BACSU
[Raw transfer]




FMT_B_8(4R7T)
NAGB_VIBCH
[Raw transfer]




66 Fugue 93.6141%-117 - C5 -1NE7 - GNPI1_HUMAN -
25 PsiBlast_CBE 92.9541%-117 - C5 -1NE7 - GNPI1_HUMAN -
55 HHSearch 92.9042%-118 - C5 -1NE7 - GNPI1_HUMAN -
24 PsiBlast_CBE 92.7941%-118 - C5 -1NE7 - GNPI1_HUMAN -
56 HHSearch 92.5750%-100 - C5 -2BKX 4.3 NAGB_BACSU
26 PsiBlast_CBE 92.3141%-117 - C5 -1NE7 - GNPI1_HUMAN -
3 PsiBlast_PDB 92.1741%-115 - C5 -1NE7 - GNPI1_HUMAN -
22 PsiBlast_CBE 92.1450%-100 - C5 -2BKV 3.2 NAGB_BACSU
23 PsiBlast_CBE 91.9641%-118 - C5 -1NE7 - GNPI1_HUMAN -
2 PsiBlast_PDB 91.4250% -98 - C5 -2BKX 4.3 NAGB_BACSU
58 HHSearch 91.2845%-119 - C5 -2RI0 - NAGB_STRMU -
27 PsiBlast_CBE 91.2141%-117 - C5 -1NE7 - GNPI1_HUMAN -
21 PsiBlast_CBE 90.9550% -96 - C5 -2BKX 4.4 NAGB_BACSU
42 PsiBlast_CBE 90.3537%-118 - C5 -1DEA - NAGB_ECOLI -
67 Fugue 89.9437%-119 * C5 *1DEA - NAGB_ECOLI -
1 PsiBlast_PDB 89.8250% -99 - C5 -2BKV 2.5 NAGB_BACSU
44 PsiBlast_CBE 89.6738%-108 - C5 -3HN6 - NAGB_BORBU -
6 PsiBlast_PDB 89.6744%-112 - C5 -2RI0 - NAGB_STRMU -
36 PsiBlast_CBE 89.5537%-116 - C5 -2WU1 2.5 NAGB_ECOLI
10 PsiBlast_PDB 89.5237%-114 - C5 -1CD5 - NAGB_ECOLI -
29 PsiBlast_CBE 88.6340%-110 - C5 -5HJ5 5.0 NAGB_VIBCH
16 PsiBlast_PDB 88.2937%-115 - C5 -2WU1 3.3 NAGB_ECOLI
5 PsiBlast_PDB 88.1544%-112 - C5 -2RI1 3.7 NAGB_STRMU
38 PsiBlast_CBE 88.1437%-114 - C5 -1HOR 5.1 NAGB_ECOLI
28 PsiBlast_CBE 87.9140%-110 - C5 -5HJ5 4.8 NAGB_VIBCH
7 PsiBlast_PDB 87.9037%-115 - C5 -1HOR 4.8 NAGB_ECOLI
34 PsiBlast_CBE 87.6644%-107 - C5 -2RI1 3.4 NAGB_STRMU
4 PsiBlast_PDB 87.6040%-110 - C5 -5HJ5 4.9 NAGB_VIBCH
11 PsiBlast_PDB 87.5937%-116 - C5 -1FQO 4.5 NAGB_ECOLI
54 HHSearch 87.5741%-112 - C5 -5HJ5 4.9 NAGB_VIBCH
41 PsiBlast_CBE 87.5737%-115 - C5 -1FQO 4.2 NAGB_ECOLI
13 PsiBlast_PDB 87.4037%-115 - C5 -1FS5 2.5 NAGB_ECOLI
30 PsiBlast_CBE 87.3740%-109 - C5 -5HJ5 4.8 NAGB_VIBCH
32 PsiBlast_CBE 86.7740%-112 - C5 -4R7T 3.3 NAGB_VIBCH