@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu02480: (2016-06-04 )
MKRSISIFITCLLIAVLTMGGLLPSPASAAGTKTPVAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQWYGDFVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQSLRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLNYLDSKNISWVNWNLSDKQESSSALKPGASKTGGWPLTDLTASGTFVRENIRGTKDSTKDVPETPAQDNPTQEKGVSVQYKAGDGRVNSNQIRPQLHIKNNGNATVDLKDVTARYWYNVKNKGQNFDCDYAQMGCGNLTHKFVTLHKPKQGADTYLELGFKTGTLSPGASTGNIQLRLHNDDWSNYAQSGDYSFFQSNTFKTTKKITLYHQGKLIWGTEPN

Atome Classification :

(31 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CTR_A_2(3A3H)
GUN5_BACAG
[Raw transfer]




CTR_A_2(1HF6)
GUN5_BACAG
[Raw transfer]




DCB_A_2(1H2J)
GUN5_BACAG
[Raw transfer]




DCB_A_2(4A3H)
GUN5_BACAG
[Raw transfer]




IDC_A_4(8A3H)
GUN5_BACAG
[Raw transfer]




FCT_A_7(1QI2)
GUN5_BACAG
[Raw transfer]




FCT_A_2(6A3H)
GUN5_BACAG
[Raw transfer]




FCT_A_2(1H11)
GUN5_BACAG
[Raw transfer]




FFC_A_2(5A3H)
GUN5_BACAG
[Raw transfer]




CBI_A_2(2A3H)
GUN5_BACAG
[Raw transfer]




CBI_A_2(1QI0)
GUN5_BACAG
[Raw transfer]




IDR_A_7(2V38)
GUN5_BACAG
[Raw transfer]




BGC_A_3(1OCQ)
GUN5_BACAG
[Raw transfer]




SUGAR_A_5(1W3L)
GUN5_BACAG
[Raw transfer]

-

GOL_B_4(3PZU)
GUN2_BACSU
[Raw transfer]




CBI_A_2(1G0C)
GUN_BACS6
[Raw transfer]




BGC_A_2(1W3K)
GUN5_BACAG
[Raw transfer]




GOL_B_6(3PZT)
GUN2_BACSU
[Raw transfer]




GOL_A_3(3PZU)
GUN2_BACSU
[Raw transfer]




SSG_A_15(1H5V)
GUN5_BACAG
[Raw transfer]




OXZ_A_6(1W3L)
GUN5_BACAG
[Raw transfer]




CBI_B_3(1TVP)
?
[Raw transfer]




TRS_A_3(4M1R)
?
[Raw transfer]




EPE_A_5(4XZW)
?
[Raw transfer]




EPE_A_5(4XZW)
?
[Raw transfer]




EPE_A_4(1TVP)
?
[Raw transfer]




SGC_A_16(1H5V)
GUN5_BACAG
[Raw transfer]




SUGAR_A_8(1E5J)
GUN5_BACAG
[Raw transfer]

-

GLC_A_14(1H5V)
GUN5_BACAG
[Raw transfer]




GLC_A_6(1E5J)
GUN5_BACAG
[Raw transfer]




SGC_A_17(1H5V)
GUN5_BACAG
[Raw transfer]




2 PsiBlast_PDB 82.9395% -65 - C1 -3PZU - GUN2_BACSU -
1 PsiBlast_PDB 82.5695% -68 - C1 -3PZT - GUN2_BACSU -
22 PsiBlast_CBE 82.3995% -68 - C1 -3PZT 2.4 GUN2_BACSU
3 PsiBlast_PDB 81.8595% -61 - C1 -3PZV - GUN2_BACSU -
21 PsiBlast_CBE 81.0395% -64 - C1 -3PZU 3.1 GUN2_BACSU
14 PsiBlast_PDB 79.0070% -76 - C1 -1HF6 6.3 GUN5_BACAG
18 PsiBlast_PDB 78.9570% -75 - C1 -1W3K 2.9 GUN5_BACAG
16 PsiBlast_PDB 78.8970% -76 - C1 -1H2J 7.5 GUN5_BACAG
20 PsiBlast_PDB 78.7170% -77 - C1 -1QHZ - GUN5_BACAG -
8 PsiBlast_PDB 78.7170% -76 - C1 -1H5V 2.7 GUN5_BACAG
13 PsiBlast_PDB 78.6570% -76 - C1 -8A3H 5.8 GUN5_BACAG
15 PsiBlast_PDB 78.6470% -74 - C1 -1H11 3.1 GUN5_BACAG
9 PsiBlast_PDB 78.5870% -77 - C1 -4A3H 7.7 GUN5_BACAG
12 PsiBlast_PDB 78.5170% -75 - C1 -7A3H - GUN5_BACAG -
11 PsiBlast_PDB 78.4470% -77 - C1 -6A3H 4.8 GUN5_BACAG
27 PsiBlast_CBE 78.4370% -72 - C1 -4XZW 2.3 ?
26 PsiBlast_CBE 78.3870% -78 - C1 -1E5J 2.6 GUN5_BACAG
6 PsiBlast_PDB 78.3370% -76 - C1 -2A3H 4.2 GUN5_BACAG
19 PsiBlast_PDB 78.2370% -76 - C1 -1W3L 4.7 GUN5_BACAG
79 HHSearch 78.2270% -76 - C1 -7A3H - GUN5_BACAG -
17 PsiBlast_PDB 78.2070% -77 - C1 -1OCQ 2.9 GUN5_BACAG
23 PsiBlast_CBE 77.7770% -76 - C1 -2V38 2.9 GUN5_BACAG
81 HHSearch 77.6469% -73 - C1 -4XZW 2.3 ?
25 PsiBlast_CBE 77.4070% -77 - C1 -1QI0 3.8 GUN5_BACAG
10 PsiBlast_PDB 77.2670% -74 - C1 -5A3H 3.0 GUN5_BACAG
7 PsiBlast_PDB 77.2170% -73 - C1 -3A3H 5.3 GUN5_BACAG
24 PsiBlast_CBE 75.8170% -74 - C1 -1QI2 4.9 GUN5_BACAG
34 PsiBlast_CBE 74.8237% -76 - C1 -1G0C 3.9 GUN_BACS6
83 HHSearch 67.1248% -72 - C1 -4M1R 3.0 ?
43 PsiBlast_CBE 64.9543% -86 - C1 -1TVP 4.4 ?
44 PsiBlast_CBE 63.9443% -91 - C1 -1TVP 2.9 ?