@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu02550: (2016-06-04 )
MLVEDDHSISEMVDHYLTKEGFGIVHAFDGEEGIRLFQQGSYDLVLLDIMLPKLNGMDFLKIIREKSNIPVLMISAKDGDVDKALGLGFGADDYIAKPFSMIELTARVKAAIRRATQYSAEEPAVNKVIRIHQLAIDIDNVSVLKNGEPLQLTSTEWQLLCLFASNPKKVFTKEQIYRSVWNEEYFDDQNIINVHMRRLREKIEDDPSSPQYIKTLWGIGYKLGEF

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_B_24(5DCL)
?
[Raw transfer]




GOL_C_13(4QPJ)
CTRA_BRUA2
[Raw transfer]




36 PsiBlast_PDB 81.1838%-144 - C4 -2GWR - MTRA_MYCTU -
1 HHSearch 80.6042%-132 - C4 -2GWR - MTRA_MYCTU -
50 PsiBlast_PDB 75.4932%-147 - C4 -1KGS - ? -
34 PsiBlast_PDB 73.5130%-150 - C4 -4KFC - KDPE_ECOLI -
2 HHSearch 73.0531%-140 - C4 -4KFC - KDPE_ECOLI -
35 PsiBlast_PDB 72.9330%-152 - C4 -4KNY - KDPE_ECOLI -
10 HHSearch 71.5534%-136 - C4 -1KGS - ? -
4 HHSearch 70.7132%-133 - C3 -1YS7 - PRRA_MYCTU -
47 PsiBlast_PDB 69.1533%-152 - C3 -1YS7 - PRRA_MYCTU -
46 PsiBlast_PDB 68.6933%-146 - C3 -1YS6 - PRRA_MYCTU -
53 PsiBlast_CBE 66.9533%-141 - C3 -1YS7 - PRRA_MYCTU -
33 PsiBlast_PDB 66.4437%-108 - C3 -2OQR - REGX3_MYCTU -
54 PsiBlast_CBE 65.4333%-138 - C3 -1YS6 - PRRA_MYCTU -
7 HHSearch 64.5538% -92 - C3 -2OQR - REGX3_MYCTU -
9 HHSearch 64.3930%-134 - C4 -4S04 - ? -
48 PsiBlast_PDB 63.1032%-132 - C- -3Q9S - ? -
8 HHSearch 60.0833%-141 - C3 -1P2F - ? -
3 HHSearch 59.6028%-113 - C4 -2HQR - ? -
42 PsiBlast_PDB 59.4746%-171 - C4 -1NXX - ? -
73 PsiBlast_CBE 58.7940%-182 - C4 -2JBA - PHOB_ECOLI -
64 PsiBlast_CBE 53.2543%-151 - C4 -4QPJ 2.9 CTRA_BRUA2
55 PsiBlast_CBE 50.5633%-176 - C4 -5DCL 3.5 ?