@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu02820: (2016-06-04 )
MRAKIPSEEVAVKLNEWYKLIRAFEADQAEALKQEIEYDLEDMEENQDLLLYFSLMEFRHRIMLDKLMPVKDSDTKPPFSDMLNEIESNQQKLTGLLEYYFYYFRGMYEFKQKNFILAIDHYKHAEEKLEYVEDEIEKAEFLFKVAEVYYHIKQTYFSMNYASQALDIYTKYELYGRRRVQCEFIIAGNLTDVYHHEKALTHLCSALEHARQLEEAYMIAAAYYNVGHCKYSLGDYKEAEGYFKTAAAIFEEHNFQQAVQAVFSLTHIYCKEGKYDKAVEAYDRGIKSAAEWEDDMYLTKFRLIHELYLGSGDLNVLTECFDLLESRQLLADAEDLLHDTAERFNQLEHYESAAFFYRRLMNIKKKLAEQRFQ

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_C_3(4GYO)
RAPJ_BACSU
[Raw transfer]

-

CHAIN_D_4(4GYO)
RAPJ_BACSU
[Raw transfer]

-

21 PsiBlast_CBE 98.18100%-118 - C2 -4GYO 8.4 RAPJ_BACSU
38 HHSearch 97.37100%-120 - C2 -4GYO 8.8 RAPJ_BACSU
1 PsiBlast_PDB 97.28100%-120 - C2 -4GYO - RAPJ_BACSU -
2 PsiBlast_PDB 81.8242%-111 - C2 -4I9E - RAPF_BACSU -
39 HHSearch 81.3743%-111 - C2 -3ULQ - RAPF_BACSU -
22 PsiBlast_CBE 80.9942%-113 - C2 -4I9E - RAPF_BACSU -
4 PsiBlast_PDB 80.7242%-112 - C2 -3ULQ - RAPF_BACSU -
3 PsiBlast_PDB 80.3242%-100 - C2 -4I9C - RAPF_BACSU -
24 PsiBlast_CBE 79.9840%-116 - C2 -4I1A - RAPI_BACSU -
28 Fugue 78.8341%-115 - C2 -3Q15 - RAPH_BACSU -
5 PsiBlast_PDB 78.2241%-118 - C2 -3Q15 - RAPH_BACSU -
41 HHSearch 77.6041%-117 - C2 -3Q15 - RAPH_BACSU -
23 PsiBlast_CBE 75.5541%-119 - C2 -3Q15 - RAPH_BACSU -
6 PsiBlast_PDB 71.0040%-117 - C2 -4I1A - RAPI_BACSU -
42 HHSearch 70.6140%-116 - C2 -4I1A - RAPI_BACSU -
40 HHSearch 59.7219%-126 - C2 -4GPK - ? -
7 PsiBlast_PDB 59.6819%-128 - C2 -4GPK - ? -
50 HHSearch 54.7714% -97 - C2 -3ULQ - RAPF_BACSU -
45 HHSearch 54.6314% -64 - C2 -4WND - GPSM2_HUMAN -
44 HHSearch 54.0212% -77 - C2 -4WND - GPSM2_HUMAN -