@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu02830: (2016-06-04 )
MYKDLTGKTAIVTGSSKGIGKAIAERFGKEKMNVVVNYHSDPSGADETLEIIKQNGGKAVSVEADVSKEEGIQALLDTALEHFGTLDVMVNNSGFNGVEAMPHEMSLEDWQRVIDVNVTGTFLGAKAALNHMMKNNIKGNVLNISSVHQQIPRPVNVQYSTSKGGIKMMTETLALNYADKGIRVNAIAPGTIATESNVDTKKEESRQKQLKKIPMKAFGKPEEVAAAAAWLVSEEASYVTGATLFVDGGMTLYPSQLE

Atome Classification :

(36 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAI_A_5(3AY6)
DHG4_BACME
[Raw transfer]




NAI_C_11(3AY6)
DHG4_BACME
[Raw transfer]




NAI_B_3(3AUT)
DHG4_BACME
[Raw transfer]




NAD_O_15(1GCO)
DHG_BACME
[Raw transfer]




NAD_L_12(1GEE)
DHG_BACME
[Raw transfer]




NAI_D_14(3AY6)
DHG4_BACME
[Raw transfer]




NAD_K_11(1GEE)
DHG_BACME
[Raw transfer]




NAD_I_9(1GCO)
DHG_BACME
[Raw transfer]




NAI_B_9(3AY6)
DHG4_BACME
[Raw transfer]




NAD_K_11(1G6K)
DHG_BACME
[Raw transfer]




NAD_K_11(1GCO)
DHG_BACME
[Raw transfer]




NAD_O_15(1RWB)
DHG_BACME
[Raw transfer]




NAD_I_9(1GEE)
DHG_BACME
[Raw transfer]




NAD_J_10(1G6K)
DHG_BACME
[Raw transfer]




NAD_L_12(1G6K)
DHG_BACME
[Raw transfer]




NAD_K_11(1RWB)
DHG_BACME
[Raw transfer]




NAD_M_13(1GCO)
DHG_BACME
[Raw transfer]




NAD_J_10(1GEE)
DHG_BACME
[Raw transfer]




NAD_I_9(1G6K)
DHG_BACME
[Raw transfer]




NAP_B_6(4DMM)
?
[Raw transfer]




NAD_I_9(1RWB)
DHG_BACME
[Raw transfer]




NAP_D_8(4DMM)
?
[Raw transfer]




NAD_I_9(1GEE)
DHG_BACME
[Raw transfer]




NAI_E_5(2DTE)
?
[Raw transfer]




NAD_A_5(2CFC)
HCDR_XANP2
[Raw transfer]




NAP_C_7(4DMM)
?
[Raw transfer]




NAD_C_9(2CFC)
HCDR_XANP2
[Raw transfer]




NAD_M_13(1RWB)
DHG_BACME
[Raw transfer]




NAD_B_7(2CFC)
HCDR_XANP2
[Raw transfer]




NAI_G_7(2DTE)
?
[Raw transfer]




GOL_A_3(3GED)
?
[Raw transfer]




1PS_B_6(4URE)
?
[Raw transfer]




BGC_B_4(3AUU)
DHG4_BACME
[Raw transfer]




BGC_A_3(3AUU)
DHG4_BACME
[Raw transfer]




EDO_B_22(3RRO)
FABG_VIBCH
[Raw transfer]




EDO_A_10(3RRO)
FABG_VIBCH
[Raw transfer]




EDO_A_11(3RRO)
FABG_VIBCH
[Raw transfer]




2 PsiBlast_PDB 81.4255% -57 - C1 -1RWB 9.6 DHG_BACME
24 PsiBlast_CBE 80.7455% -56 - C1 -1RWB 9.2 DHG_BACME
26 PsiBlast_CBE 79.3955% -53 - C1 -1RWB 9.6 DHG_BACME
25 PsiBlast_CBE 78.9755% -57 - C1 -1RWB 8.8 DHG_BACME
27 PsiBlast_CBE 78.0555% -56 - C1 -1GCO 10.2 DHG_BACME
22 PsiBlast_CBE 77.7155% -57 - C1 -1GEE 10.2 DHG_BACME
23 PsiBlast_CBE 77.4855% -55 - C1 -1GEE 10.4 DHG_BACME
21 PsiBlast_CBE 77.4155% -56 - C1 -1GEE 10.3 DHG_BACME
3 PsiBlast_PDB 77.4155% -55 - C1 -1GCO 10.1 DHG_BACME
30 PsiBlast_CBE 77.2155% -58 - C1 -1G6K 9.3 DHG_BACME
1 PsiBlast_PDB 77.0355% -56 - C1 -1GEE 10.3 DHG_BACME
28 PsiBlast_CBE 76.9755% -56 - C1 -1GCO 10.2 DHG_BACME
29 PsiBlast_CBE 76.6455% -54 - C1 -1GCO 10.3 DHG_BACME
32 PsiBlast_CBE 76.6355% -56 - C1 -1G6K 9.5 DHG_BACME
31 PsiBlast_CBE 76.4255% -59 - C1 -1G6K 9.3 DHG_BACME
4 PsiBlast_PDB 75.3355% -56 - C1 -1G6K 9.3 DHG_BACME
111 HHSearch 75.1355% -52 - C1 -1GEE 6.0 DHG_BACME
9 PsiBlast_PDB 74.5151% -59 - C1 -3AY6 10.5 DHG4_BACME
13 PsiBlast_PDB 74.3639% -76 - C1 -2UVD - ? -
37 PsiBlast_CBE 74.2351% -59 - C1 -3AY6 9.9 DHG4_BACME
38 PsiBlast_CBE 73.7251% -55 - C1 -3AY6 7.0 DHG4_BACME
35 PsiBlast_CBE 73.0051% -56 - C1 -3AUT 9.6 DHG4_BACME
34 PsiBlast_CBE 72.5151% -57 - C1 -3AUU 3.1 DHG4_BACME
8 PsiBlast_PDB 72.2951% -56 - C1 -3AUU 3.4 DHG4_BACME
36 PsiBlast_CBE 72.1451% -53 - C1 -3AY6 7.3 DHG4_BACME
63 PsiBlast_CBE 69.5335% -93 - C1 -2DTE 7.0 ?
64 PsiBlast_CBE 68.9435% -92 - C1 -2DTE 7.7 ?
72 PsiBlast_CBE 68.8538% -82 - C1 -2CFC 6.7 HCDR_XANP2
51 PsiBlast_CBE 68.0139% -88 - C1 -4DMM 8.5 ?
50 PsiBlast_CBE 67.4539% -87 - C1 -4DMM 7.6 ?
73 PsiBlast_CBE 67.1038% -82 - C1 -2CFC 6.5 HCDR_XANP2
74 PsiBlast_CBE 66.5938% -81 - C1 -2CFC 6.1 HCDR_XANP2
52 PsiBlast_CBE 64.9639% -81 - C1 -4DMM 9.7 ?
47 PsiBlast_CBE 64.0440% -65 - C1 -4URE 3.5 ?
93 PsiBlast_CBE 59.5635% -71 - C1 -3RRO 2.6 FABG_VIBCH
92 PsiBlast_CBE 58.9735% -73 - C1 -3RRO 2.6 FABG_VIBCH