@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu02840: (2016-06-04 )
MKTDWWKDAVVYQIYPRSFQDSNGDGIGDLRGIISRLDYIKELGADVIWICPIYPSPNVDYGYDVTNHKAIMDSYGTMDDFHELLDQVHQRGLKLVMDFVLNHTSVEHPWFKEAELDKNSKYRSYYYWRPGTKNGPPTDWLSNYGCPVWQYEEHTGEYYLHMNAVKQADLNWENPEVRQAVYDMMKFWLDKGVDGLRIDQLHLISKKEYLPSYEDYINQQAEPKPFQPNGERIHDYLKEITDEVFSHYDVMSVGEVGSVTPEEGLKYTGTDKHELNMIFHFQHMELDQQPGKEHWDLKPLELSDLKSVLTKWQKKLEHQGWNTLFWCNHDQPRIVSRFGDDGEYRKASAKMLAAVIYFMKGTPYIYQGEEIGMTNAPFTRIEDYKDIQTINMYHKRVFEKGYDPNDVMRSILAKSRDHARTPMQWNSGKNAGFTDGTPWLKVNPNFTAINVEEAQGDPDSVLNYYKKLISLRKQYADLMKGSFDLLLPDDPQLFVYMRENSKQQLLSVNNFSKEQAVFQWPKNCGKAQASLLLSNYNNDDLDDEMVFRPYESRVYLLDKTN

Atome Classification :

(66 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TEU_B_6(4H8V)
?
[Raw transfer]




ISL_A_4(4HA1)
?
[Raw transfer]




GLC_A_2(3AXI)
MALX3_YEAST
[Raw transfer]




BGC_A_6(3WY3)
?
[Raw transfer]




GLC_A_2(3A4A)
MALX3_YEAST
[Raw transfer]




BGC_B_10(3WY3)
?
[Raw transfer]




GLC_A_4(4H7V)
?
[Raw transfer]




GLC_A_4(4HOZ)
?
[Raw transfer]




NOJ_B_6(2PWD)
?
[Raw transfer]




GLC_B_6(4H7V)
?
[Raw transfer]




CTS_B_6(2PWG)
?
[Raw transfer]




NOJ_A_5(2PWD)
?
[Raw transfer]




NOJ_A_11(3GBE)
?
[Raw transfer]




GLC_A_4(4HP5)
?
[Raw transfer]




GLO_A_3(4M56)
O16G1_BACSU
[Raw transfer]




GLC_B_6(4HA1)
?
[Raw transfer]




CTS_A_5(2PWG)
?
[Raw transfer]




GOL_B_8(4GI9)
?
[Raw transfer]




GOL_B_10(4GI6)
?
[Raw transfer]




TRS_B_6(4GO8)
?
[Raw transfer]




GOL_A_5(4AIE)
?
[Raw transfer]




GOL_A_5(4GI8)
?
[Raw transfer]




GOL_A_5(4GIA)
?
[Raw transfer]




GOL_A_5(4GI6)
?
[Raw transfer]




GOL_B_15(4GI8)
?
[Raw transfer]




GOL_B_12(4GIA)
?
[Raw transfer]




BGC_A_2(4WLC)
DEXB_STRMU
[Raw transfer]




GOL_A_5(4GI9)
?
[Raw transfer]




GOL_A_5(4AIE)
?
[Raw transfer]




TRS_B_6(1ZJA)
?
[Raw transfer]




TRS_A_5(1ZJB)
?
[Raw transfer]




BGC_A_8(3WY2)
?
[Raw transfer]




GOL_A_3(4GIN)
?
[Raw transfer]




TRS_A_4(4GO8)
?
[Raw transfer]




GOL_A_3(4H2C)
?
[Raw transfer]




GLO_B_7(4M56)
O16G1_BACSU
[Raw transfer]




BGC_A_8(3WY2)
?
[Raw transfer]




TRS_B_6(1ZJB)
?
[Raw transfer]




TRS_A_2(4M8U)
O16G1_BACSU
[Raw transfer]




TRS_A_2(4MB1)
O16G1_BACSU
[Raw transfer]




GOL_B_11(3WY2)
?
[Raw transfer]




GOL_A_3(4HOW)
?
[Raw transfer]




TRS_A_2(4MB1)
O16G1_BACSU
[Raw transfer]




TRS_A_2(4MAZ)
O16G1_BACSU
[Raw transfer]




TRS_B_6(4GO9)
?
[Raw transfer]




GOL_A_3(4M8U)
O16G1_BACSU
[Raw transfer]




TRS_A_4(4GO9)
?
[Raw transfer]




TRS_A_5(2ZIC)
DEXB_STRMU
[Raw transfer]




TRS_A_5(1ZJA)
?
[Raw transfer]




TRS_A_5(1ZJA)
?
[Raw transfer]




TRS_A_2(4HOX)
?
[Raw transfer]




EDO_A_4(3GBD)
?
[Raw transfer]




GLC_A_3(3AXH)
MALX3_YEAST
[Raw transfer]




MAL_A_2(5A2B)
?
[Raw transfer]




EDO_A_2(3GBD)
?
[Raw transfer]




MAL_A_2(5A2C)
?
[Raw transfer]




105 HHSearch 73.2149% -63 - C1 -5BRQ - ? -
103 HHSearch 72.8954% -59 - C1 -1UOK - O16G_BACCE -
2 PsiBlast_PDB 72.6248% -66 - C1 -5BRQ - ? -
22 PsiBlast_CBE 72.5848% -63 - C1 -5BRQ - ? -
23 PsiBlast_CBE 72.1648% -65 - C1 -5BRQ - ? -
1 PsiBlast_PDB 72.0853% -59 - C1 -1UOK - O16G_BACCE -
3 PsiBlast_PDB 72.0348% -64 - C1 -5BRP - ? -
21 PsiBlast_CBE 71.9248% -65 - C1 -5BRQ - ? -
25 PsiBlast_CBE 71.2048% -65 - C1 -5BRP - ? -
24 PsiBlast_CBE 70.9148% -64 - C1 -5BRP - ? -
107 HHSearch 70.2748% -55 - C1 -4MB1 3.4 O16G1_BACSU
7 PsiBlast_PDB 70.1047% -52 - C1 -4M8U 3.5 O16G1_BACSU
110 HHSearch 69.9248% -58 - C1 -4AIE 2.2 ?
26 PsiBlast_CBE 69.7848% -63 - C1 -5BRP - ? -
9 PsiBlast_PDB 69.6547% -59 - C1 -4AIE 2.2 ?
5 PsiBlast_PDB 69.4347% -52 - C1 -4MAZ 3.3 O16G1_BACSU
8 PsiBlast_PDB 69.3347% -54 - C1 -4MB1 3.4 O16G1_BACSU
29 PsiBlast_CBE 69.2447% -54 - C1 -4M56 2.5 O16G1_BACSU
6 PsiBlast_PDB 69.1447% -54 - C1 -4M56 4.0 O16G1_BACSU
27 PsiBlast_CBE 68.3349% -58 - C1 -5DO8 - ? -
14 PsiBlast_PDB 67.5841% -56 - C1 -4HP5 4.9 ?
15 PsiBlast_PDB 66.1841% -56 - C1 -4HOZ 4.0 ?
10 PsiBlast_PDB 65.8741% -53 - C1 -4HOW 4.3 ?
11 PsiBlast_PDB 65.7741% -53 - C1 -4HOX 4.4 ?
16 PsiBlast_PDB 65.4645% -63 - C1 -2ZIC 4.5 DEXB_STRMU
17 PsiBlast_PDB 64.8045% -65 - C1 -4WLC 4.7 DEXB_STRMU
20 PsiBlast_PDB 64.6440% -56 - C1 -3GBD 3.9 ?
106 HHSearch 64.1940% -57 - C1 -1ZJA 4.0 ?
30 PsiBlast_CBE 63.7140% -52 - C1 -3GBE 4.0 ?
47 PsiBlast_CBE 63.6541% -57 - C1 -4GIA 2.9 ?
48 PsiBlast_CBE 62.9941% -58 - C1 -4GI9 4.3 ?
35 PsiBlast_CBE 62.7241% -58 - C1 -2PWD 3.7 ?
51 PsiBlast_CBE 62.7141% -58 - C1 -4GI8 4.4 ?
69 PsiBlast_CBE 62.6340% -62 * C1 *4H7V 4.8 ?
44 PsiBlast_CBE 62.5941% -55 - C1 -2PWG 3.9 ?
43 PsiBlast_CBE 62.4341% -56 - C1 -2PWG 3.8 ?
57 PsiBlast_CBE 62.4041% -56 - C1 -4GO9 4.3 ?
75 PsiBlast_CBE 62.3337% -45 - C1 -3AXH 2.4 MALX3_YEAST
50 PsiBlast_CBE 62.3341% -58 - C1 -4GI8 2.9 ?
53 PsiBlast_CBE 62.3141% -58 - C1 -4GI6 4.0 ?
39 PsiBlast_CBE 62.3041% -57 - C1 -1ZJA 4.3 ?
65 PsiBlast_CBE 62.2940% -60 - C1 -4HA1 4.5 ?
31 PsiBlast_CBE 62.1641% -56 - C1 -4GO8 4.4 ?
74 PsiBlast_CBE 62.1437% -44 - C1 -3AXI 5.4 MALX3_YEAST
66 PsiBlast_CBE 62.0040% -60 - C1 -4HA1 4.0 ?
37 PsiBlast_CBE 62.0041% -58 - C1 -1ZJB 4.3 ?
49 PsiBlast_CBE 61.9941% -57 - C1 -4GI9 2.0 ?
36 PsiBlast_CBE 61.9841% -57 - C1 -2PWD 3.8 ?
40 PsiBlast_CBE 61.9741% -58 - C1 -1ZJA 4.0 ?
38 PsiBlast_CBE 61.9641% -58 - C1 -1ZJB 4.3 ?
58 PsiBlast_CBE 61.9341% -58 - C1 -4GO9 4.4 ?
32 PsiBlast_CBE 61.9341% -57 - C1 -4GO8 4.2 ?
70 PsiBlast_CBE 61.8840% -59 - C1 -4H7V 4.7 ?
72 PsiBlast_CBE 61.8537% -43 - C1 -3A4A 5.5 MALX3_YEAST
54 PsiBlast_CBE 61.8041% -59 - C1 -4H2C 3.8 ?
46 PsiBlast_CBE 61.8041% -58 - C1 -4GIA 2.7 ?
52 PsiBlast_CBE 61.7741% -56 - C1 -4GI6 4.2 ?
33 PsiBlast_CBE 61.5241% -56 - C1 -4H8V 4.3 ?
45 PsiBlast_CBE 61.0541% -59 - C1 -4GIN 2.7 ?
114 HHSearch 55.9932% -63 - C1 -3WY2 4.9 ?
76 PsiBlast_CBE 53.2132% -66 - C1 -3WY2 4.2 ?
82 PsiBlast_CBE 52.8232% -65 - C1 -3WY3 5.4 ?
77 PsiBlast_CBE 52.2532% -63 - C1 -3WY2 4.9 ?
81 PsiBlast_CBE 51.9032% -64 - C1 -3WY3 5.3 ?
92 PsiBlast_CBE 22.9233% -99 - C1 -5A2B 2.7 ?
91 PsiBlast_CBE 22.8233% -97 - C1 -5A2C 2.2 ?