@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu03050: (2016-06-05 )
MNKHVNKVALIGAGFVGSSYAFALINQGITDELVVIDVNKEKAMGDVMDLNHGKAFAPQPVKTSYGTYEDCKDADIVCICAGANQKPGETRLELVEKNLKIFKGIVSEVMASGFDGIFLVATNPVDILTYATWKFSGLPKERVIGSGTTLDSARFRFMLSEYFGAAPQNVHAHIIGEHGDTELPVWSHANVGGVPVSELVEKNDAYKQEELDQIVDDVKNAAYHIIEKKGATYYGVAMSLARITKAILHNENSILTVSTYLDGQYGADDVYIGVPAVVNRGGIAGITELNLNEKEKEQFLHSAGVLKNILKPHFAEQKVN

Atome Classification :

(51 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_H_8(1EZ4)
LDH_LACPE
[Raw transfer]




NAD_C_5(3PQF)
LDH_BACSU
[Raw transfer]




NAD_D_6(3PQF)
LDH_BACSU
[Raw transfer]




NAD_A_8(1A5Z)
LDH_THEMA
[Raw transfer]




NAD_D_16(3VPH)
LDH_THECA
[Raw transfer]




NAD_A_7(3VPH)
LDH_THECA
[Raw transfer]




NAD_B_11(3VPH)
LDH_THECA
[Raw transfer]




NAD_A_6(2V7P)
LDH_THET8
[Raw transfer]




NAD_C_10(2V7P)
LDH_THET8
[Raw transfer]




NAD_T_17(1LTH)
LDH2_BIFL2
[Raw transfer]




NAD_F_6(1EZ4)
LDH_LACPE
[Raw transfer]




NAD_B_8(3WSW)
?
[Raw transfer]




ENA_A_2(2X0J)
MDH_ARCFU
[Raw transfer]




NAD_P_16(2LDB)
LDH_GEOSE
[Raw transfer]




NAD_G_7(1EZ4)
LDH_LACPE
[Raw transfer]




NAD_D_12(2V7P)
LDH_THET8
[Raw transfer]




NAD_R_18(2LDB)
LDH_GEOSE
[Raw transfer]




NAD_B_7(2XXJ)
LDH_THET8
[Raw transfer]




NAD_B_7(1LLD)
LDH2_BIFL2
[Raw transfer]




NAD_O_15(2LDB)
LDH_GEOSE
[Raw transfer]




NAD_A_5(1LLD)
LDH2_BIFL2
[Raw transfer]




NAD_Q_17(2LDB)
LDH_GEOSE
[Raw transfer]




NAD_D_10(2XXJ)
LDH_THET8
[Raw transfer]




NAD_E_5(1EZ4)
LDH_LACPE
[Raw transfer]




NAD_D_13(3WSW)
?
[Raw transfer]




NAD_E_5(1EZ4)
LDH_LACPE
[Raw transfer]




NAD_A_5(3WSW)
?
[Raw transfer]




NAD_C_11(3WSW)
?
[Raw transfer]




NAD_R_21(1LTH)
LDH2_BIFL2
[Raw transfer]




NAD_B_8(2V7P)
LDH_THET8
[Raw transfer]




OXM_C_13(3VPH)
LDH_THECA
[Raw transfer]




OXM_A_2(4PLZ)
LDH_PLAFD
[Raw transfer]




MPD_A_6(4M1Q)
?
[Raw transfer]




MPD_A_6(4M1Q)
?
[Raw transfer]




2 PsiBlast_PDB 93.4399%-143 - C5 -3PQE - LDH_BACSU -
107 HHSearch 93.2199%-144 - C5 -3PQE - LDH_BACSU -
28 PsiBlast_CBE 92.7899%-151 - C5 -3PQF 8.5 LDH_BACSU
23 PsiBlast_CBE 92.66100%-142 - C5 -3PQD - LDH_BACSU -
3 PsiBlast_PDB 92.5199%-143 - C5 -3PQF - LDH_BACSU -
24 PsiBlast_CBE 90.77100%-136 - C5 -3PQD - LDH_BACSU -
1 PsiBlast_PDB 90.51100%-137 - C5 -3PQD - LDH_BACSU -
29 PsiBlast_CBE 90.4699%-147 - C5 -3PQF 8.3 LDH_BACSU
22 PsiBlast_CBE 90.41100%-154 - C5 -3PQD - LDH_BACSU -
21 PsiBlast_CBE 89.12100%-146 - C5 -3PQD - LDH_BACSU -
27 PsiBlast_CBE 88.44100%-135 - C5 -3PQD - LDH_BACSU -
25 PsiBlast_CBE 88.28100%-143 - C5 -3PQD - LDH_BACSU -
37 PsiBlast_CBE 86.9068%-155 - C5 -1LDN - LDH_GEOSE -
26 PsiBlast_CBE 86.35100%-141 - C5 -3PQD - LDH_BACSU -
39 PsiBlast_CBE 86.3068%-156 - C5 -1LDN - LDH_GEOSE -
35 PsiBlast_CBE 86.0668%-152 - C5 -1LDN - LDH_GEOSE -
36 PsiBlast_CBE 85.9868%-155 - C5 -1LDN - LDH_GEOSE -
34 PsiBlast_CBE 85.4768%-156 - C5 -1LDN - LDH_GEOSE -
38 PsiBlast_CBE 85.3868%-157 - C5 -1LDN - LDH_GEOSE -
40 PsiBlast_CBE 84.3768%-148 - C5 -1LDN - LDH_GEOSE -
114 HHSearch 80.2461%-142 - C5 -4M1Q 3.1 ?
12 PsiBlast_PDB 80.0359%-143 - C5 -4M1Q 3.1 ?
30 PsiBlast_CBE 79.2268%-154 - C5 -2LDB 6.9 LDH_GEOSE
32 PsiBlast_CBE 79.1968%-154 - C5 -2LDB 7.1 LDH_GEOSE
5 PsiBlast_PDB 79.0668%-154 - C5 -2LDB 7.1 LDH_GEOSE
31 PsiBlast_CBE 78.9468%-154 - C5 -2LDB 7.0 LDH_GEOSE
68 PsiBlast_CBE 73.4452%-133 - C5 -3WSW 8.1 ?
67 PsiBlast_CBE 72.8452%-138 - C5 -3WSW 8.1 ?
97 PsiBlast_CBE 72.2243%-152 - C5 -1A5Z 7.2 LDH_THEMA
88 PsiBlast_CBE 71.7543%-135 - C5 -2XXJ 10.6 LDH_THET8
20 PsiBlast_PDB 71.5652%-133 - C5 -3WSW 8.0 ?
66 PsiBlast_CBE 71.1352%-130 - C5 -3WSW 7.1 ?
86 PsiBlast_CBE 70.9943%-130 - C5 -2XXJ 10.5 LDH_THET8
113 HHSearch 70.9342%-135 - C5 -1LLD 8.0 LDH2_BIFL2
118 HHSearch 70.8552%-137 * C5 *1EZ4 9.3 LDH_LACPE
72 PsiBlast_CBE 70.5253%-124 - C5 -1EZ4 9.1 LDH_LACPE
80 PsiBlast_CBE 70.4143%-131 - C5 -2V7P 11.3 LDH_THET8
75 PsiBlast_CBE 70.1453%-134 - C5 -1EZ4 9.3 LDH_LACPE
74 PsiBlast_CBE 70.1153%-125 - C5 -1EZ4 9.5 LDH_LACPE
92 PsiBlast_CBE 69.8842%-133 - C5 -3VPH 9.6 LDH_THECA
78 PsiBlast_CBE 69.4643%-128 - C5 -2V7P 10.6 LDH_THET8
77 PsiBlast_CBE 69.1843%-139 - C5 -2V7P 9.3 LDH_THET8
79 PsiBlast_CBE 69.0043%-144 - C5 -2V7P 8.3 LDH_THET8
73 PsiBlast_CBE 68.7453%-131 - C5 -1EZ4 9.3 LDH_LACPE
93 PsiBlast_CBE 68.5042%-135 - C5 -3VPH 2.3 LDH_THECA
95 PsiBlast_CBE 67.9742%-134 - C5 -3VPH 10.1 LDH_THECA
94 PsiBlast_CBE 67.9042%-134 - C5 -3VPH 9.8 LDH_THECA
100 PsiBlast_CBE 62.6043%-125 - C5 -1LLD 7.5 LDH2_BIFL2
98 PsiBlast_CBE 61.0543%-123 - C5 -1LTH 8.5 LDH2_BIFL2
99 PsiBlast_CBE 57.6043%-112 - C5 -1LTH 8.8 LDH2_BIFL2
112 HHSearch 53.7135%-116 - C5 -2X0J 9.7 MDH_ARCFU