@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu03130: (2016-06-05 )
MSMQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKKTGAKGFVLGISGGQDSTLAGRLAQLAVESIREEGGDAQFIAVRLPHGTQQDEDDAQLALKFIKPDKSWKFDIKSTVSAFSDQYQQETGDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK

Atome Classification :

(33 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADJ_A_18(1KQP)
NADE_BACSU
[Raw transfer]




ADJ_B_19(1KQP)
NADE_BACSU
[Raw transfer]




ADJ_A_18(1KQP)
NADE_BACSU
[Raw transfer]




NAD_B_10(2NSY)
NADE_BACSU
[Raw transfer]




NAD_A_8(2NSY)
NADE_BACSU
[Raw transfer]




NAD_A_8(2NSY)
NADE_BACSU
[Raw transfer]




DND_A_4(1EE1)
NADE_BACSU
[Raw transfer]




APC_B_6(2PZ8)
NADE_BACAN
[Raw transfer]




APC_A_6(1IH8)
NADE_BACSU
[Raw transfer]




APC_A_5(2PZ8)
NADE_BACAN
[Raw transfer]




DND_B_5(1EE1)
NADE_BACSU
[Raw transfer]




AMP_A_4(1FYD)
NADE_BACSU
[Raw transfer]




AMP_A_9(1NSY)
NADE_BACSU
[Raw transfer]




DND_C_3(1IFX)
NADE_BACSU
[Raw transfer]




AMP_B_7(2PZA)
NADE_BACAN
[Raw transfer]




AMP_A_8(2PZA)
NADE_BACAN
[Raw transfer]




ATP_B_5(1NSY)
NADE_BACSU
[Raw transfer]




AMP_C_17(3FIU)
?
[Raw transfer]




AMP_D_22(3FIU)
?
[Raw transfer]




NAD_A_2(5F23)
NADE_PSEAE
[Raw transfer]




AMP_A_7(3FIU)
?
[Raw transfer]




AMP_A_7(3FIU)
?
[Raw transfer]




AMP_B_12(3FIU)
?
[Raw transfer]




NAD_A_2(5F23)
NADE_PSEAE
[Raw transfer]




AMP_A_5(1WXI)
NADE_ECOLI
[Raw transfer]




DND_A_5(1XNG)
NADE_HELPY
[Raw transfer]




AMP_A_5(1WXI)
NADE_ECOLI
[Raw transfer]




NAD_B_2(1WXH)
NADE_ECOLI
[Raw transfer]




DND_B_6(1XNG)
NADE_HELPY
[Raw transfer]




AMP_A_3(1WXE)
NADE_ECOLI
[Raw transfer]




MES_A_3(5F23)
NADE_PSEAE
[Raw transfer]




4 PsiBlast_PDB 87.02100% -40 - C5 -1FYD 4.3 NADE_BACSU
23 PsiBlast_CBE 86.80100% -34 - C5 -1KQP 7.4 NADE_BACSU
43 HHSearch 86.58100% -39 - C5 -1KQP 7.4 NADE_BACSU
7 PsiBlast_PDB 86.58100% -39 - C5 -1KQP 7.4 NADE_BACSU
21 PsiBlast_CBE 86.39100% -37 - C5 -2NSY 6.1 NADE_BACSU
1 PsiBlast_PDB 86.14100% -38 - C5 -1NSY 4.7 NADE_BACSU
64 Fugue 86.11100% -37 - C5 -2NSY 7.1 NADE_BACSU
2 PsiBlast_PDB 86.11100% -37 - C5 -2NSY 7.1 NADE_BACSU
22 PsiBlast_CBE 85.84100% -37 - C5 -1NSY 3.7 NADE_BACSU
6 PsiBlast_PDB 85.31100% -30 - C5 -1IH8 6.5 NADE_BACSU
3 PsiBlast_PDB 84.87100% -32 - C5 -1EE1 6.5 NADE_BACSU
29 PsiBlast_CBE 80.8777% -43 - C5 -2PZ8 7.1 NADE_BACAN
26 PsiBlast_CBE 80.84100% -69 - C5 -1EE1 5.8 NADE_BACSU
28 PsiBlast_CBE 80.6577% -40 - C5 -2PZA 4.1 NADE_BACAN
24 PsiBlast_CBE 80.39100% -63 - C5 -1IH8 - NADE_BACSU -
8 PsiBlast_PDB 80.3877% -39 - C5 -2PZ8 7.2 NADE_BACAN
25 PsiBlast_CBE 79.40100% -73 - C5 -1IFX 6.0 NADE_BACSU
9 PsiBlast_PDB 79.3377% -38 - C5 -2PZA 4.4 NADE_BACAN
5 PsiBlast_PDB 78.72100% -68 - C5 -1IFX - NADE_BACSU -
46 HHSearch 75.8558% -57 - C5 -4Q16 - NADE_DEIRA -
20 PsiBlast_PDB 72.0248% -88 - C5 -5F23 6.5 NADE_PSEAE
11 PsiBlast_PDB 71.2354% -77 - C5 -1WXE 3.5 NADE_ECOLI
15 PsiBlast_PDB 70.3754% -68 - C5 -1WXI 4.5 NADE_ECOLI
14 PsiBlast_PDB 70.1454% -74 - C5 -1WXH 6.6 NADE_ECOLI
44 HHSearch 68.4553% -64 - C5 -1WXI 4.5 NADE_ECOLI
45 HHSearch 67.6849% -84 - C5 -5F23 6.5 NADE_PSEAE
48 HHSearch 59.5238% -65 - C5 -3FIU 4.3 ?
34 PsiBlast_CBE 58.6738% -61 - C5 -3FIU 4.7 ?
33 PsiBlast_CBE 58.3738% -62 - C5 -3FIU 4.4 ?
36 PsiBlast_CBE 57.7538% -61 - C5 -3FIU 4.3 ?
35 PsiBlast_CBE 57.6938% -59 - C5 -3FIU 4.6 ?
39 PsiBlast_CBE 46.1831% -57 - C5 -1XNG 5.8 NADE_HELPY
40 PsiBlast_CBE 44.8031% -54 - C5 -1XNG 5.6 NADE_HELPY