@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu03210: (2016-06-05 )
MTTPYKHEPFTNFQDQNNVEAFKKALATVSEYLGKDYPLVINGERVETEAKIVSINPADKEEVVGRVSKASQEHAEQAIQAAAKAFEEWRYTSPEERAAVLFRAAAKVRRRKHEFSALLVKEAGKPWNEADADTAEAIDFMEYYARQMIELAKGKPVNSREGEKNQYVYTPTGVTVVIPPWNFLFAIMAGTTVAPIVTGNTVVLKPASATPVIAAKFVEVLEESGLPKGVVNFVPGSGAEVGDYLVDHPKTSLITFTGSREVGTRIFERAAKVQPGQQHLKRVIAEMGGKDTVVVDEDADIELAAQSIFTSAFGFAGQKCSAGSRAVVHEKVYDQVLERVIEITESKVTAKPDSADVYMGPVIDQGSYDKIMSYIEIGKQEGRLVSGGTGDDSKGYFIKPTIFADLDPKARLMQEEIFGPVVAFCKVSDFDEALEVANNTEYGLTGAVITNNRKHIERAKQEFHVGNLYFNRNCTGAIVGYHPFGGFKMSGTDSKAGGPDYLALHMQAKTISEMF

Atome Classification :

(49 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ALA_B_8(2EJD)
?
[Raw transfer]




ALA_A_7(2EJD)
?
[Raw transfer]




NAD_B_11(2J40)
?
[Raw transfer]




NAD_A_5(2J40)
?
[Raw transfer]




NAD_A_10(2EIT)
?
[Raw transfer]




GLU_A_3(2BHQ)
?
[Raw transfer]




NAP_A_9(2EHQ)
?
[Raw transfer]




GLU_B_4(2BHQ)
?
[Raw transfer]




NAD_A_5(2J5N)
?
[Raw transfer]




NAP_B_10(2EHQ)
?
[Raw transfer]




DPR_A_7(2EJ6)
?
[Raw transfer]




NAD_B_12(2EIT)
?
[Raw transfer]




NAD_A_10(2EHU)
?
[Raw transfer]




NAD_B_10(2BJK)
?
[Raw transfer]




DPR_B_8(2EJ6)
?
[Raw transfer]




NAD_A_3(2BHP)
?
[Raw transfer]




NAD_B_12(2EHU)
?
[Raw transfer]




NAD_B_12(2EII)
?
[Raw transfer]




NAD_B_15(2BHP)
?
[Raw transfer]




NAD_B_13(2J5N)
?
[Raw transfer]




NAD_A_3(2BJK)
?
[Raw transfer]




NAD_A_10(2EII)
?
[Raw transfer]




FLC_B_11(2IY6)
?
[Raw transfer]




FLC_A_3(2IY6)
?
[Raw transfer]




GLY_B_4(2J5N)
?
[Raw transfer]




GLY_A_3(2J5N)
?
[Raw transfer]




PRO_A_6(4E3X)
AL4A1_MOUSE
[Raw transfer]




NAD_B_7(2BJA)
?
[Raw transfer]




NAD_A_3(2BJA)
?
[Raw transfer]




MPD_A_11(2EJD)
?
[Raw transfer]




MPD_B_18(2EJD)
?
[Raw transfer]




MPD_A_11(2EJ6)
?
[Raw transfer]




MPD_B_18(2EJL)
?
[Raw transfer]




MPD_A_11(2EJL)
?
[Raw transfer]




MPD_B_16(2EIW)
?
[Raw transfer]




MPD_A_11(2EIW)
?
[Raw transfer]




MPD_B_17(2EJ6)
?
[Raw transfer]




MRD_B_17(2IY6)
?
[Raw transfer]




MRD_A_7(2IY6)
?
[Raw transfer]




25 PsiBlast_CBE 91.2990% -77 - C4 -3RJL - ROCA_BACLD -
27 PsiBlast_CBE 90.2790% -76 - C4 -3RJL - ROCA_BACLD -
21 PsiBlast_CBE 89.7190% -75 - C4 -3RJL - ROCA_BACLD -
1 PsiBlast_PDB 88.8190% -74 - C4 -3RJL - ROCA_BACLD -
26 PsiBlast_CBE 88.7390% -73 - C4 -3RJL - ROCA_BACLD -
107 HHSearch 87.2774% -73 - C4 -3QAN - ROCA1_BACHD -
2 PsiBlast_PDB 86.8073% -73 - C4 -3QAN - ROCA1_BACHD -
28 PsiBlast_CBE 85.3773% -72 - C4 -3QAN - ROCA1_BACHD -
47 PsiBlast_CBE 82.0848% -84 - C4 -4NMF - ? -
48 PsiBlast_CBE 81.9848% -82 - C4 -4NME - ? -
50 PsiBlast_CBE 81.6348% -82 - C4 -4NMD - ? -
58 PsiBlast_CBE 81.5948% -81 - C4 -4NM9 - ? -
56 PsiBlast_CBE 81.4848% -82 - C4 -4NMA - ? -
46 PsiBlast_CBE 81.3048% -82 - C4 -4NMF - ? -
54 PsiBlast_CBE 81.2348% -83 - C4 -4NMB - ? -
55 PsiBlast_CBE 81.2048% -82 - C4 -4NMB - ? -
51 PsiBlast_CBE 81.1248% -81 - C4 -4NMD - ? -
39 PsiBlast_CBE 81.1250% -75 - C4 -2EIW 3.0 ?
52 PsiBlast_CBE 81.0848% -79 - C4 -4NMC - ? -
20 PsiBlast_PDB 80.9848% -80 - C4 -4NM9 - ? -
43 PsiBlast_CBE 80.6950% -74 - C4 -2EJD 3.0 ?
14 PsiBlast_PDB 80.0850% -75 - C4 -2EIW 2.7 ?
8 PsiBlast_PDB 79.9950% -75 - C4 -2BHQ 3.7 ?
30 PsiBlast_CBE 79.8750% -72 - C4 -2IY6 3.3 ?
31 PsiBlast_CBE 79.7550% -72 - C4 -2EJ6 2.7 ?
16 PsiBlast_PDB 79.7550% -73 - C4 -2J40 7.7 ?
3 PsiBlast_PDB 79.7050% -74 - C4 -2BHP 7.7 ?
9 PsiBlast_PDB 79.6950% -73 - C4 -2J5N 8.5 ?
41 PsiBlast_CBE 79.6850% -73 - C4 -2J40 7.5 ?
35 PsiBlast_CBE 79.6550% -72 - C4 -2EHQ 8.5 ?
37 PsiBlast_CBE 79.5550% -72 - C4 -2BHQ 3.7 ?
18 PsiBlast_PDB 79.4950% -73 - C4 -2EJL 3.9 ?
42 PsiBlast_CBE 79.3850% -72 - C4 -2EJL 4.2 ?
17 PsiBlast_PDB 79.3850% -72 - C4 -2EJD 2.6 ?
7 PsiBlast_PDB 79.3650% -75 - C4 -2EJ6 3.6 ?
15 PsiBlast_PDB 79.2850% -73 - C4 -2BJA 5.9 ?
10 PsiBlast_PDB 79.2650% -72 - C4 -2EIT 8.6 ?
29 PsiBlast_CBE 79.2450% -72 - C4 -2J5N 8.1 ?
5 PsiBlast_PDB 79.1450% -72 - C4 -2IY6 3.4 ?
11 PsiBlast_PDB 78.9850% -73 - C4 -2EHU 8.1 ?
6 PsiBlast_PDB 78.9850% -73 - C4 -2EHQ 8.8 ?
38 PsiBlast_CBE 78.9450% -72 - C4 -2BHP 7.8 ?
32 PsiBlast_CBE 78.9450% -72 - C4 -2EIT 8.1 ?
44 PsiBlast_CBE 78.6750% -72 - C4 -2BJA 5.7 ?
34 PsiBlast_CBE 78.6150% -72 - C4 -2EHU 8.1 ?
4 PsiBlast_PDB 78.6050% -71 - C4 -2BJK 7.7 ?
12 PsiBlast_PDB 78.5350% -72 - C4 -2EII 7.7 ?
36 PsiBlast_CBE 78.3050% -71 - C4 -2BJK 8.0 ?
33 PsiBlast_CBE 78.3050% -71 - C4 -2EII 7.8 ?